KEGG   Ralstonia solanacearum GMI1000: RSc1390Help
Entry
RSc1390           CDS       T00071                                 

Gene name
dapE
Definition
(GenBank) probable succinyl-diaminopimelate desuccinylase protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00300  Lysine biosynthesis
rso01100  Metabolic pathways
rso01120  Microbial metabolism in diverse environments
rso01230  Biosynthesis of amino acids
Module
rso_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RSc1390 (dapE)
Enzymes [BR:rso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RSc1390 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CAD15092
UniProt: Q8XZK5
Position
complement(1482385..1483545)
Genome map
AA seq 386 aa AA seqDB search
MTAMSPTLALTEDLIRRRSVTPEDKGCQDVLIERLSAAGFQCETVVSGPDHFRVTNLWAV
KRGRAGTDGKLLVFAGHTDVVPTGPVEQWRSDPFEPTHRDGKLYGRGAADMKTSIAGFVV
AAEEFVAVHPDHAGSIGFLITSDEEGPAHDGTIKVCDLLRTRGERLDYCVVGEPTSVSTL
GDMVKNGRRGSLSGKLTVNGVQGHIAYPHLAKNPIHLAVPALTALAAEQWDDGNAYFPPT
TWQMSNIHGGTGATNVIPGHVIIDFNFRFSTASTPEGLKSRVHAILDAHGLDYTLAWTLG
GEPFLTERGELSEALSSAIGAECGVATELSTTGGTSDGRFIAKLCPQVIEFGPPNASIHK
IDEHVDVAFIEPLKNVYRRVLETLIA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccatgtcgcccacgcttgccctcactgaagacctgatccgccgccgctccgtc
acgcccgaagacaagggctgccaggatgtgctgatcgaacgcctgtccgccgccggcttc
caatgcgaaaccgtggtcagcgggccggaccacttccgcgtgaccaacctgtgggccgtc
aagcgcggccgcgcgggtaccgacggcaagctgctggtcttcgccggccacaccgacgtg
gtgccgaccggccccgtggagcagtggcgctccgacccgttcgagccgacccaccgcgac
ggcaagctctatggccgcggcgccgccgacatgaaaacctcgatcgccgggttcgtggta
gccgccgaggaattcgtcgccgtgcatccggaccacgccggctcgatcggcttcctgatc
accagtgacgaggaaggcccggcccacgacggcaccatcaaggtctgcgacctgctgcgc
acgcgcggcgagcggctggactactgcgtggtgggcgagccgacctcggtgtccacgctc
ggcgacatggtcaagaacgggcgacgcggctcgctgtcgggcaagctgaccgtcaacggc
gtgcagggccacatcgcctatccgcacctggccaagaacccgatccacctggccgtgccg
gcgctgaccgcgctggcggccgagcagtgggacgacggcaacgcctacttcccgccgacc
acctggcagatgtcgaacatccacggcggcaccggcgcgaccaacgtgattccgggccac
gtcatcatcgacttcaacttccgcttctcgacggcgagcacgccggagggcctgaagtcg
cgcgtgcacgccatcctcgacgcgcacggcctggactacacgctggcctggacgctgggc
ggcgagcccttcctgaccgagcgcggcgagctgtcggaggcgctgtcgtcggccatcggg
gccgagtgcggcgtcgccactgaactgtcgaccaccggcggcacgtcggacggccgcttc
atcgccaagctgtgcccgcaggtgatcgagttcgggccgcccaacgccagcatccacaag
atcgacgagcacgtcgatgtggccttcatcgagccgctcaagaacgtgtaccggcgcgtg
ctggaaacactgatcgcctga

DBGET integrated database retrieval system