KEGG   Ralstonia solanacearum GMI1000: RSc1410Help
Entry
RSc1410           CDS       T00071                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSc1410 (dxr)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RSc1410 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1508933..1510114
Genome map
AA seq 393 aa AA seqDB search
MMRITVLGATGSIGDSTLDVVRRHPDRYRVFALTANTQVDKLAALCRVFRPAMAVVGSAT
AAEVLRDQLGAEATGIDIRFGPEALEEAAAHPDCDAVMAAIVGAAGLRPTLAAVRAGKRV
LLANKEALVMSGALFMDAVRQHGATVLPIDSEHNAIFQCLPQQRPSFGHGVARIVLTASG
GPFRTRAVETLAEVTPDQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNVPVERLE
VLIHPQSVIHSMVAYDDGSVLAQLGNPDMRTPIAYGLAYPERIEAGVPLLDLAATGTLAF
EAPDLHRFPCLALAFDALRAGGTAPAVLNAANEVAVEAFLQRRIRFTEIAAVVGDTLART
AIGPADSLDTVFAADAQARRRAEHYIAASCLQS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcattaccgttcttggcgccaccggctccatcggcgacagcacgctcgacgtg
gtgcgccgccatcccgaccgttaccgcgtgttcgcactgaccgccaacacgcaggtcgat
aagcttgccgcgctgtgccgcgtgttccgtccggcgatggcggtggtcggctcggccacc
gcggccgaggtgctgcgggaccagctcggcgcggaggccaccggcatcgacatccgcttc
ggccccgaggcgctggaagaggccgccgcccaccccgattgcgatgccgtgatggccgcc
atcgtcggcgcggccggcctgcgcccgacgctggcggccgtgcgcgcgggcaagcgtgtg
ctgctggccaacaaggaagcgctggtgatgtccggcgcgctcttcatggacgcggtgcgc
cagcatggcgccaccgtgctgccgatcgacagcgagcataacgccatcttccagtgcctg
ccccagcagcgtccgagcttcgggcacggtgtggcgcgcatcgtgctgacggcgtcgggc
ggcccgttccgcacgcgcgccgtcgagacgctggccgaggtcacgcccgatcaggcctgc
gcccatccgaactgggtgatgggccgcaagatttccgtcgactccgccaccatgatgaac
aaggggctggaggtgatcgaggcgcactggctgttcaacgtgccggtcgagcggctcgag
gtgctgatccacccgcagagcgtgatccattcgatggtcgcttacgatgacggttcggtc
ctggcgcaactgggcaaccccgacatgcggacgccgatcgcctacgggcttgcgtacccc
gagcgcatcgaggccggcgtgccgctgctggatctggccgcgaccggcacgcttgcgttc
gaagcgcccgatctgcaccgcttcccgtgtctggccctggctttcgacgcactgcgcgcc
ggcggcacggcgcctgcggtgctgaatgcggccaacgaggtggcggtcgaggcatttttg
cagcgccgtatccgcttcaccgagattgccgcggtggtgggcgacacgctggcgcgcacc
gccatcgggccggcggattcgctggacacggtgtttgccgccgatgcgcaggcgcgccgc
cgcgccgagcactatatcgctgcctcgtgcctgcagtcgtga

DBGET integrated database retrieval system