KEGG   Ralstonia solanacearum GMI1000: RSc1501Help
Entry
RSc1501           CDS       T00071                                 

Gene name
mel
Definition
tyrosinase oxidoreductase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSc1501 (mel)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RSc1501 (mel)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     RSc1501 (mel)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606005..1607243
Genome map
AA seq 412 aa AA seqDB search
MRIDFTINNGGDAAARYLTWAPSPLRLRLLDATPGPDVVATLSEDRQPNGGSIRFCATPD
GNFTPTLKVPLPASGASVTVYVRGKFGTPSQADGDVSIVVGGPASELGRLPVMVRVRKNA
NQLTPAERDRFISAMAQINNRGTGRFTDFRNMHVAGRADQQAHGGPGFLPWHRAYLLDLE
RELQAIDPAVTIPYWRFDRPAPNLFTTDFIGVPDALGTVSFSPANPLQFWATDGVQGILR
RQLGASPGAQAAPNILTEAQTLALGSAYRNFRGMQGNPHGSAHVSYFSGSISSIPTAAKD
PLFFLLHCNVDRLWAKWQSQVGRYDANVAAAYDAGPTPTSLLAGHNLHDTLWPWNGIVTP
PRPSTAPGGAMAGSSCVSAPGNAPRVSDMLDFQGVVSSSAKLGFAYDDVPLP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgacttcacgatcaacaacggtggtgacgcagccgcgcgctacctcacctgg
gcgccgtcgccattgcggcttcgcctgctcgatgccacgccggggccggatgtggtcgca
accctgtcggaagatcgccagcccaatggcggctccatccggttctgtgcgacgcccgat
ggcaacttcaccccgacgctcaaagtgccgctgccggcgagcggcgcctccgtgacggtc
tacgttcgcggaaaattcggcacgcccagccaggccgatggcgacgtcagtatcgtggtc
ggcgggccggcgtcggaactcggccgcttgcccgtcatggtgcgggtgcgcaagaacgcg
aatcagctgaccccggccgagcgggaccgcttcatctcggccatggcgcagatcaacaac
cgggggacggggcggttcaccgatttccgcaacatgcacgtcgcgggccgtgccgatcag
caggcccatggcggccccggcttcctgccgtggcaccgggcctatctgctcgacctggag
cgcgagctgcaggccatcgaccccgcggtgacgatcccgtattggcgcttcgatcggccg
gcgccgaatctgttcaccaccgacttcatcggcgtgccggatgcgctcggcacggtgagt
ttcagcccggccaacccgctgcagttctgggccaccgacggcgtgcaagggatcctgagg
cgccagctgggcgcgagccccggcgcgcaggccgccccgaacatcctgaccgaggcgcag
acgctggcgctcggcagtgcgtaccggaatttccggggcatgcagggcaatccgcacggc
tccgcgcatgtcagctatttctcgggcagcatctcgtcgatcccgaccgccgccaaggat
ccgctgttcttcctgctgcactgcaatgtcgacaggctgtgggccaaatggcagtcgcag
gtggggcggtacgatgcgaacgtggcggccgcctatgacgccggtccgacgccgacgagc
ctgctcgcgggccacaatctgcacgacacgctgtggccgtggaacggcatcgtgacgccg
cctcggccgtcgaccgcccccggcggagccatggccggatcgtcgtgcgtctcggcgccg
gggaacgcgccccgcgtcagcgacatgctggacttccagggggtggtgagcagttcggcc
aagctcggctttgcctacgacgatgtgcccttgccctga

DBGET integrated database retrieval system