KEGG   Ralstonia solanacearum GMI1000: RSc1505Help
Entry
RSc1505           CDS       T00071                                 

Definition
alcohol dehydrogenase (EC:1.1.1.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RSc1505
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSc1505
  Lipid metabolism
   00071 Fatty acid degradation
    RSc1505
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSc1505
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSc1505
   00626 Naphthalene degradation
    RSc1505
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSc1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1610507..1611511)
Genome map
AA seq 334 aa AA seqDB search
MQAMVCSRAGAPLQWQTVPRPEPGPGEVRIAVSVCGVCRTDLHIVDGELPDPKPALIPGH
EIVGTVDACGPGVSGLTTGERVGVPWLGWSCGTCPFCRRDQENLCDRPRFTGYTRDGGYA
EYTVCDARYCLPIPARYDDAHAAPLLCAGLIGYRTLRMAGDARRLGIYGFGAAAHLVTQI
AVAEQREVFAFTRAGDTGAQQLARDTGACWAGASEAPPPAPLDAALIFAPVGALVPLALQ
AVVKGGTVVCGGIHMSDIPAFPYRLLWEERKLMSVANLTRADGLALMRVAATVPLQSHVT
LYPLAEANAALDDLRAGRVTGAAVLQVRSPIDGP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccatggtctgctcgcgcgccggtgcgccgctgcaatggcagaccgtgccgcgg
cccgaacccggtcccggtgaagtccggatcgcggtgtcggtgtgcggcgtctgccggacg
gacctgcatatcgtcgacggcgaattgcccgatccgaagccggcgctgattccggggcac
gagatcgtcggcacggtcgatgcgtgcggacccggcgtcagcgggctcaccacgggcgag
cgcgtcggcgtgccctggctgggctggagctgcggcacctgcccgttctgccggcgcgac
caggaaaacctgtgcgaccggccgcgcttcaccggctacacgcgtgacggcggctacgcc
gaatacaccgtttgcgatgcccgctactgccttcccatcccggcacggtacgacgatgcc
cacgcggcgcctctgctctgcgcggggctgatcggctaccgtacgctgcgcatggcgggc
gacgcgcgccgccttggcatctatggcttcggcgcggcggcccacctggtcacgcagatt
gccgtggccgagcagcgcgaagtctttgccttcacccgggcgggggataccggcgcgcag
cagctcgcgcgcgacaccggcgcctgctgggcgggcgcgagcgaagcgccgccgcccgcg
ccgctcgatgccgcgctgatcttcgccccggtgggggcgctggtgccgctcgcgctgcag
gccgtcgtcaagggtggcacggtggtctgcggcggcatccacatgagcgacatcccggcg
tttccctatcggctgctctgggaagaacgcaagctgatgtcggtagcgaacctgacgcgc
gccgacggcctggcgctgatgcgcgtggcggcgacggtgccgctgcaatcgcacgtcacg
ctctacccgctcgccgaagccaatgccgcgctcgatgatctgcgcgcgggacgggtgacc
ggcgcggccgtcctccaggtccggagcccgatcgacgggccttga

  All links  
No link information was found.   
DBGET integrated database retrieval system