KEGG   Ralstonia solanacearum GMI1000: RSc1637Help
Entry
RSc1637           CDS       T00071                                 

Gene name
bktB
Definition
(GenBank) probable beta-ketothiolase protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSc1637 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    RSc1637 (bktB)
   00640 Propanoate metabolism
    RSc1637 (bktB)
   00650 Butanoate metabolism
    RSc1637 (bktB)
  Lipid metabolism
   00071 Fatty acid degradation
    RSc1637 (bktB)
   00072 Synthesis and degradation of ketone bodies
    RSc1637 (bktB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSc1637 (bktB)
   00310 Lysine degradation
    RSc1637 (bktB)
   00380 Tryptophan metabolism
    RSc1637 (bktB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSc1637 (bktB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSc1637 (bktB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSc1637 (bktB)
Enzymes [BR:rso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RSc1637 (bktB)
Exosome [BR:rso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSc1637 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1758926..1760110
Genome map
AA seq 394 aa AA seqDB search
MAREVVVVSGVRTAVGTFGGSLKDVAPCELGALVVREALARAQVGGEEVGHVVFGHVINT
EPRDMYLSRVAALEGGVPAETPAFNVNRLCGSGLQAVVSAAQTILLGDVDVAIGGGAESM
SRAPYLAPAARWGSRMGDAGLVDMMLGALHDPFQAIHMGVTAENVAREYGIGRELQDQTA
VESHRRASRAIQAGYFKGQIVPVTIKSRKGDVQFDTDEHVRHDATLEDMAKLRPVFAKEN
GTVTAGNASGLNDAAAALVLMERSLAERRGLKPLARLVSYGHAGVDPKVMGIGPVPATRK
ALERAGLTVKDLDVVEANEAFAAQACAVTQQLGLDPARVNPNGSGISLGHPIGATGALIT
VKALHELQRIGGRYALVTMCIGGGQGIAAVFERI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtgaagtggtggtggtcagcggtgtccgcaccgcggtcgggacgttcggcggc
agcctgaaggacgtggcgccgtgcgagctgggcgccctggtggtgcgcgaggcgctggcg
cgcgcgcaggtcgggggcgaggaggtcggccacgtggtgttcggccacgtcatcaatacc
gagccgcgcgacatgtacctgtcgcgcgtggccgccctggaaggcggcgtgccggccgag
acgcccgcgttcaacgtcaaccgcctgtgcggctccggcctgcaggccgtggtgagcgcc
gcgcagaccatcctgctgggcgatgtcgacgtcgccatcggcggcggcgccgagagcatg
agccgcgcgccgtacctggcgccggcggcgcgctggggttcgcgcatgggcgacgccggg
ctggtcgacatgatgctgggcgcgctgcacgacccgttccaggcgatccacatgggcgtg
acggcggagaacgtcgcccgcgaatacggcatcggtcgcgaactgcaggaccagaccgcg
gtggagtcgcatcggcgtgcgtcgcgcgccatccaggccggctatttcaagggccagatc
gtcccggtgacgatcaagtcgcgcaagggcgatgtgcagttcgataccgacgaacatgtc
cgccatgatgcgaccctcgaggacatggccaagctcaggccggtcttcgcgaaggaaaac
ggcaccgtgacggcgggcaacgcctcgggcctgaacgatgcggccgcggccctggtgctg
atggagcgctcgctggccgagcggcgcggcctgaagccgctggcgcggctggtgtcatac
ggccacgcgggcgtggacccgaaggtgatgggcatcggcccggtgccggcgacgcgcaag
gcgctggagcgggccgggctgacggtcaaggacctggacgtggtggaggccaacgaggcc
ttcgcggcccaggcctgcgcggtgacgcagcagctgggcctggacccggccagagtcaac
ccgaacggctcgggcatttcgctcggccatccgatcggcgcgaccggcgccctgatcacg
gtgaaggcgctgcacgagctgcagcgcatcggcggccgctacgcgttggtgaccatgtgc
attggtggaggacaaggcattgccgcggtgttcgaacgcatctga

DBGET integrated database retrieval system