KEGG   Ralstonia solanacearum GMI1000: RSc1717Help
Entry
RSc1717           CDS       T00071                                 

Definition
esterase (EC:3.1.-.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rso01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1836574..1837224)
Genome map
AA seq 216 aa AA seqDB search
MGLAAALGCAMIGILPMTPAAAAQGTAAAPRRVVVLGDSLSAGYGLAQGTGWVTLLGNRL
KERKLDYSVANASISGDTTAGGRARLPAVLAREKPTVVVLELGANDALRGLSLSASEANL
KAMIEASQATGARVLLVGMRIPPNYGPDYSERFFAMFGRLAQQYRLPLVPFFLEGVAQRP
DWFQEDRIHPVAAAQPTLLDNVWPKLEPLLKGRVGG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgggactcgcagccgcgctcggctgcgcgatgatcggcatcctgccgatgacgcccgct
gcggcggcgcagggcaccgcagcggcgccgcgccgcgtggtggtgctgggcgacagcctg
tcagcgggatacggcctggcgcaaggcaccggctgggtcacactgctgggcaatcgcctg
aaagaacggaagctcgattatagcgtcgccaatgccagcatcagcggcgacaccaccgcg
ggcggccgcgcccgtctgcctgccgtgcttgcgcgcgaaaagcccaccgtggtggtactc
gaactgggtgccaacgatgcgctgcgcgggctgtcgctgtctgcgagcgaagccaacctg
aaagcgatgatcgaggcctcgcaggccaccggcgccagggtgctgctggtcggcatgcgc
atcccgcccaattacggcccggactacagcgagcgcttcttcgccatgttcggcagactg
gcgcagcaataccggctgccgctcgtgcccttcttcctggaaggcgtggcccagcggccc
gactggttccaggaggatcgcatccacccggtcgccgcggcacagccgacgctgctcgac
aatgtctggcccaagcttgaacctctgctcaagggccgggtcggaggatga

DBGET integrated database retrieval system