KEGG   Ralstonia solanacearum GMI1000: RSc1717Help
Entry
RSc1717           CDS       T00071                                 

Definition
esterase (EC:3.1.-.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RSc1717
Enzymes [BR:rso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RSc1717
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RSc1717
Lipid biosynthesis proteins [BR:rso01004]
 Fatty acid synthase
  Component type
   RSc1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1836574..1837224)
Genome map
AA seq 216 aa AA seqDB search
MGLAAALGCAMIGILPMTPAAAAQGTAAAPRRVVVLGDSLSAGYGLAQGTGWVTLLGNRL
KERKLDYSVANASISGDTTAGGRARLPAVLAREKPTVVVLELGANDALRGLSLSASEANL
KAMIEASQATGARVLLVGMRIPPNYGPDYSERFFAMFGRLAQQYRLPLVPFFLEGVAQRP
DWFQEDRIHPVAAAQPTLLDNVWPKLEPLLKGRVGG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgggactcgcagccgcgctcggctgcgcgatgatcggcatcctgccgatgacgcccgct
gcggcggcgcagggcaccgcagcggcgccgcgccgcgtggtggtgctgggcgacagcctg
tcagcgggatacggcctggcgcaaggcaccggctgggtcacactgctgggcaatcgcctg
aaagaacggaagctcgattatagcgtcgccaatgccagcatcagcggcgacaccaccgcg
ggcggccgcgcccgtctgcctgccgtgcttgcgcgcgaaaagcccaccgtggtggtactc
gaactgggtgccaacgatgcgctgcgcgggctgtcgctgtctgcgagcgaagccaacctg
aaagcgatgatcgaggcctcgcaggccaccggcgccagggtgctgctggtcggcatgcgc
atcccgcccaattacggcccggactacagcgagcgcttcttcgccatgttcggcagactg
gcgcagcaataccggctgccgctcgtgcccttcttcctggaaggcgtggcccagcggccc
gactggttccaggaggatcgcatccacccggtcgccgcggcacagccgacgctgctcgac
aatgtctggcccaagcttgaacctctgctcaagggccgggtcggaggatga

DBGET integrated database retrieval system