KEGG   Ralstonia solanacearum GMI1000: RSc1799Help
Entry
RSc1799           CDS       T00071                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase (component e2 of pyruvate dehydrogenase complex) protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00010  Glycolysis / Gluconeogenesis
rso00020  Citrate cycle (TCA cycle)
rso00620  Pyruvate metabolism
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01200  Carbon metabolism
Module
rso_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSc1799
   00020 Citrate cycle (TCA cycle)
    RSc1799
   00620 Pyruvate metabolism
    RSc1799
Enzymes [BR:rso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RSc1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAD15501
UniProt: Q8XYF9
Position
1934899..1936017
Genome map
AA seq 372 aa AA seqDB search
MIVFKLPDLGEGLQEAEIVQWHVQAGDTVEADQPLVSVETAKAIVEIPSPQAGRIARLFG
QPGDIVHLGAPLVAFEGAGGGEADAGTVVGQMQVGQQVVREAPAVLAAAPGAAAGGIKAT
PAVRALARKLDVDLSMATPSGPDGVITAADVERVAKVFSELGPPEVLRGVRRAMAQNMAR
AQSEVAAATVIDDADIHAWPPGTDVTIRLIRALVAGCRAEPGLNAWFDGHAGRRHVLEKI
DLGIAVDLPDGLFVPVLRNVAHRDAADLRAGLDRMRADIRARKIPPEELRGNTITLSNFG
MIAGKYAAPVVVPPTVAILGAGRIHEQVVAAAGAPAVHRVLPLSLTFDHRVVTGGEAARF
LAATIADLEAAH
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcttcaaactgccggatctcggcgaagggctgcaggaggcggagatcgtgcaa
tggcacgtgcaggccggcgacaccgtcgaggccgatcagccgctggtctcggtcgagacc
gccaaggccatcgtcgagattccgtcgccgcaggccggccgcatcgccaggctgttcggc
cagccgggcgacatcgtgcacctgggcgcgccgctggtcgcgttcgaaggggcgggcggc
ggtgaagcggatgcgggcaccgtggtcgggcagatgcaggtcgggcaacaggtggtgcgg
gaggcgccggccgtgctggccgccgcgcccggggcggccgccggcggcatcaaggcgacg
ccggcggtgcgggcgctggcgcgcaagctcgacgtggacctgtcgatggcgacgccctcg
gggccggacggggtcatcacggcggcggatgtcgagcgcgtggccaaggtgttctccgaa
ctggggccgcccgaggtgctgcgcggcgtgcggcgcgccatggcgcagaacatggcgcgc
gcgcagagcgaagtggccgccgccaccgtcattgacgatgccgacatccacgcttggccg
cccggcaccgatgtgaccatccgcctgatccgcgcgctggtggccggctgccgcgccgag
cccgggctcaacgcctggttcgacgggcatgcggggcggcgccacgtgctggagaagatc
gacctcggcatcgcggtcgatctgccggacgggctgttcgtgccggtgctgcgcaatgtc
gcgcaccgcgacgcggccgatctgcgcgccgggctggaccgcatgcgcgccgacatccgg
gcacgcaagattccgccggaggagttgcgcggcaacaccatcacgctgtcgaacttcggc
atgatcgcgggcaagtacgcggcgccggtggtggtgccgccgaccgtggcgatcctgggc
gcgggccgcatccacgagcaggtggtggcggccgccggtgccccggcggtgcaccgcgtg
ctgccgctgagcctgaccttcgaccaccgggtggtgaccggcggcgaggcggcgcggttc
ctggccgcgacgatcgcggacctggaagcggcgcactaa

DBGET integrated database retrieval system