KEGG   Ralstonia solanacearum GMI1000: RSc1981Help
Entry
RSc1981           CDS       T00071                                 

Gene name
trpA
Definition
(GenBank) probable tryptophan synthase alpha chain protein (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSc1981 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSc1981 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSc1981 (trpA)
Enzymes [BR:rso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSc1981 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2155704..2156501)
Genome map
AA seq 265 aa AA seqDB search
MSRIAQTFSQLSAQGRKGLIPFITAGDPYPELTVDLMHALVKGGANVIELGVPFSDPMAD
GPVIQRASERALAKKIGLRTVLDYVRAFRATDKTTPVVLMGYANPIERMGIDAFAKAASE
AGVDGVLVVDYPPEECEAFAKTMRAAGIDPIFLLAPTSTEARMAQIARVASGYIYYVSLK
GVTGAATLDLDSVAARIPQIRQHARLPVGVGFGIRDAATARAIGGVADAVVIGSRIVQLL
EEASREQAVQCLTDFIADIRQALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcattgctcaaactttttcgcaattgtccgcgcagggccgcaagggcctgatt
ccgttcatcacggcgggcgacccgtatcccgagttgaccgtcgacctgatgcatgcgctg
gtcaagggcggcgccaacgtcatcgaactgggcgtgccgttttccgacccgatggccgac
ggcccggtcatccagcgtgcgtcggagcgcgcactcgccaagaaaatcggcctgcgcacc
gtgctggactacgtgcgtgcgttccgcgccaccgacaagaccacgcccgtggtgctgatg
ggctacgccaacccgatcgagcgcatgggcatcgacgccttcgccaaggccgcgtcggaa
gccggcgtggacggcgtgctggtggtggactacccgcccgaggagtgcgaggcgttcgcc
aagaccatgcgggccgcgggcatcgacccgatcttcctgctggcgcccacgtcgaccgaa
gcgcgcatggcgcagatcgcccgcgtggcgagcggctacatctactacgtctcgctcaag
ggcgtgacgggtgcggcgacgctcgacctcgacagcgtggccgcgcgcatcccgcagatc
cgccagcacgcgcggctgccggtgggggtcggcttcggcatccgcgatgcggcgacggcg
cgcgcgatcggcggcgtggccgatgcggtggtgatcggatcccgcattgtgcaattgctg
gaggaggcgtcccgcgaacaagcggtacaatgtctgactgatttcatcgcggacatccgc
caggcgctcgacgcctga

DBGET integrated database retrieval system