KEGG   Ralstonia solanacearum GMI1000: RSc1983Help
Entry
RSc1983           CDS       T00071                                 

Gene name
trpB
Definition
(GenBank) probable tryptophan synthase beta chain protein (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSc1983 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSc1983 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSc1983 (trpB)
Enzymes [BR:rso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSc1983 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2157333..2158544)
Genome map
AA seq 403 aa AA seqDB search
MPREIAMYNLPDAHGHFGPYGGTFVAETLSHALDELRDAYARYQHDPEFIKEYEYELKHF
VGRPSPIYHARRLTEHCGGAQIYLKREDLNHTGAHKVNNVIGQALLARRMGKPRVIAETG
AGQHGVATATIAARYGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALN
EAMRDWVTNVADTFYIIGTVAGPHPYPMMVRDFQAVIGEECKVQMPELAGRQPDAVIACV
GGGSNAMGIFYPYIDHASVQLIGVEAAGEGLESGRHAASLTGGSPGVLHGNRTYLLQDED
GQIIETHSISAGLDYPGVGPEHAWLKDAGRAQYVGITDKEALQAFHDLCRMEGIIPALES
SHALAYACKLAPTLPKDKILLVNLSGRGDKDMHTVAELSGIDL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgagagattgccatgtacaacctgcccgacgcccacggccacttcggcccttac
ggcggcaccttcgttgcggaaacgctgtcccacgcgctggacgagctgcgcgatgcctat
gcgcgctatcagcacgatcccgaattcatcaaggaatacgagtacgagctgaagcatttc
gtcggccgtccgtcgcccatctaccatgcccgccgcctgaccgagcattgcggcggcgcg
cagatctacctcaagcgcgaagacctgaaccacaccggcgcgcacaaggtgaacaacgtc
atcggccaggcgctgctggcgcgccgcatgggcaagccgcgcgtgatcgccgagaccggc
gccggccagcacggcgtggccaccgccaccatcgccgcgcgctacggcatggagtgcgtg
gtctacatgggcagcgaggacgtgcgccggcaggccgccaacgtctatcgcatgaagctg
ctgggcgcgaccgtggtgccggtggagtccggttcgcgcacgctcaaggacgcgctgaat
gaagcgatgcgcgactgggtcaccaacgtggccgacaccttctacatcatcggcaccgtg
gccggtccgcacccgtatccgatgatggtgcgcgacttccaggccgtgatcggcgaggaa
tgcaaggtgcagatgcccgagctggccggccgccagccggacgccgtgatcgcctgcgtg
ggcggcggctccaacgccatgggcattttctatccgtacatcgaccatgccagcgtgcag
ttgatcggcgtggaagcggcgggcgagggcctcgagtcgggccggcatgccgcgtcgctc
acgggcggctcgccgggcgtgctgcacggcaaccgcacctatctgctgcaggacgaggac
ggccagatcatcgagacgcattcgatctcggccggcctggactaccccggtgtcggcccc
gagcatgcctggctgaaggacgcgggtcgcgcgcagtatgtcggcatcaccgacaaggaa
gcgctgcaggccttccacgacctgtgccgcatggagggcatcatccccgcgctggagtcc
agccatgcgctggcctacgcctgcaagctggcgccgacgctgccgaaggacaagatcctg
ctggtcaacctgtccggccgcggcgacaaggacatgcataccgtcgccgaactctcgggc
atcgatctctga

DBGET integrated database retrieval system