KEGG   Ralstonia solanacearum GMI1000: RSc1995Help
Entry
RSc1995           CDS       T00071                                 

Gene name
sdhD
Definition
transmembrane succinate dehydrogenase (hydrophobic membrane anchor subunit) oxidoreductase (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSc1995 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSc1995 (sdhD)
   00650 Butanoate metabolism
    RSc1995 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RSc1995 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2172591..2172956)
Genome map
AA seq 121 aa AA seqDB search
MAQNNIGPKRLVVGAHYGLKDFLAQRVTAVIMAVYTIVLLAAFLFSKDTSYQSWAGLFAN
QWMKLLTFLAFLSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaacaatatcggtcccaagcgcctcgtcgtcggcgcacactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtgatcatggcggtctacaccatcgtgctgctg
gccgcgttcctgttttcgaaagacacgtcgtaccaaagctgggcaggcctgttcgccaac
cagtggatgaagctgctgacgttcctcgctttcctgtcgctcacatatcacgcatggatc
ggcgtgcgtgacatctggatggactacgtgaagcccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgcgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system