KEGG   Ralstonia solanacearum GMI1000: RSc1995Help
Entry
RSc1995           CDS       T00071                                 

Gene name
sdhD
Definition
(GenBank) putative transmembrane succinate dehydrogenase (hydrophobic membrane anchor subunit) oxidoreductase protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00020  Citrate cycle (TCA cycle)
rso00190  Oxidative phosphorylation
rso00650  Butanoate metabolism
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01200  Carbon metabolism
Module
rso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rso_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rso_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSc1995 (sdhD)
   00650 Butanoate metabolism
    RSc1995 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RSc1995 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C MitoNEET_N
Motif
Other DBs
NCBI-ProteinID: CAD15697
UniProt: Q8XXW8
Position
complement(2172591..2172956)
Genome map
AA seq 121 aa AA seqDB search
MAQNNIGPKRLVVGAHYGLKDFLAQRVTAVIMAVYTIVLLAAFLFSKDTSYQSWAGLFAN
QWMKLLTFLAFLSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaacaatatcggtcccaagcgcctcgtcgtcggcgcacactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtgatcatggcggtctacaccatcgtgctgctg
gccgcgttcctgttttcgaaagacacgtcgtaccaaagctgggcaggcctgttcgccaac
cagtggatgaagctgctgacgttcctcgctttcctgtcgctcacatatcacgcatggatc
ggcgtgcgtgacatctggatggactacgtgaagcccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgcgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system