KEGG   Ralstonia solanacearum GMI1000: RSc2064Help
Entry
RSc2064           CDS       T00071                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSc2064 (tpiA)
   01230 Biosynthesis of amino acids
    RSc2064 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSc2064 (tpiA)
   00051 Fructose and mannose metabolism
    RSc2064 (tpiA)
   00562 Inositol phosphate metabolism
    RSc2064 (tpiA)
Enzymes [BR:rso01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RSc2064 (tpiA)
Exosome [BR:rso04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RSc2064 (tpiA)
  Exosomal proteins of bladder cancer cells
   RSc2064 (tpiA)
  Exosomal proteins of melanoma cells
   RSc2064 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2236772..2237518)
Genome map
AA seq 248 aa AA seqDB search
MSARPKLVVGNWKLHGSLNGNAELLEKIKAAGQTRAALAVCAPFPYLAQCQSVLAGSSVA
WGAQDVSAETRGAFTGEVAASMLSEFGCGYAIVGHSERRTYHGETDAQVAIKALRALEHG
ITPIVCVGETLAQREAGETELVVARQLEAVLESLSVEQLGHIVVAYEPVWAIGTGKTATS
EQAQAVHAFLRGRVAACDAGVAQRMPILYGGSVKPDNAAELFTMADIDGGLIGGASLKAE
DFLAIGRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaagaccgaagctggtggtgggcaactggaagttgcatggcagcctgaacggc
aacgccgagctgcttgagaagatcaaggcagccgggcagacccgcgccgcgctggccgtc
tgtgcaccgttcccgtacctggcccagtgccagtcggtgctcgccggctcgtcggtggcc
tggggcgcgcaggacgtgtcggccgagacgcgcggcgccttcaccggcgaggtggcggcg
tcgatgttgtcggaatttggctgcggctacgcgatcgtcgggcactcggaacgtcgcacg
tatcacggcgagaccgacgcgcaggtggcgatcaaggcgctgcgcgcgctggagcacggc
atcaccccgatcgtctgtgtcggcgaaacgctggcgcaacgcgaggccggagagaccgag
ctagtcgtggcccgtcagttggaggcggtgctggagtcgctgtcggtcgaacagctgggt
cacatcgtcgtggcctacgagccggtctgggccatcggtaccggcaagaccgcgaccagc
gagcaggcgcaggcagtgcacgcgttcctgcgtggccgcgtggctgcttgcgatgccggt
gtcgcgcagcgcatgccgatcctgtacggcggcagcgtcaagccggacaacgcggccgaa
ctgtttacgatggcagacatcgatggcggcctgatcggcggcgcatccctgaaggccgaa
gatttcctggcgatcggccgggcctga

DBGET integrated database retrieval system