KEGG   Ralstonia solanacearum GMI1000: RSc2414Help
Entry
RSc2414           CDS       T00071                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RSc2414 (holC)
   00240 Pyrimidine metabolism
    RSc2414 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RSc2414 (holC)
   03430 Mismatch repair
    RSc2414 (holC)
   03440 Homologous recombination
    RSc2414 (holC)
Enzymes [BR:rso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RSc2414 (holC)
DNA replication proteins [BR:rso03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RSc2414 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2618962..2619390)
Genome map
AA seq 142 aa AA seqDB search
MTRVDFHSNVPGKLAYACRLVRKAYGAGQKVIVVGNRAALEAFDAQLWTFSQLDFLPHCG
LRHRLAAQTPILLADASEPLDDAPHHDILVNLSDATPPLFARFARLIEIVGDDEAERAAA
RDRFRFYRDRGYPIQHHDVGRA
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgtcgatttccatagcaacgtgcccggcaagctggcttatgcctgccgcctg
gtgcgcaaggcctacggcgcgggccagaaggtgatcgtggtggggaaccgcgcagcgctg
gaggcctttgacgcccagttgtggaccttcagccagctcgacttcctgccgcactgcggg
ctgcggcatcggctcgccgcgcagacgccgattctgctggccgatgcctccgagccgctg
gacgacgcgccccatcacgacattctcgtcaacctgtcggatgccacgccgccgctgttc
gcgcggttcgcgcgcctgatcgaaatcgtcggcgacgacgaggccgagcgcgccgccgcc
cgcgaccgcttccgcttctatcgcgaccgcggctatccgatccaacatcacgacgtgggg
cgcgcatga

DBGET integrated database retrieval system