KEGG   Ralstonia solanacearum GMI1000: RSc2628Help
Entry
RSc2628           CDS       T00071                                 

Gene name
folK
Definition
(GenBank) probable 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase protein
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00790  Folate biosynthesis
rso01100  Metabolic pathways
Module
rso_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSc2628 (folK)
Enzymes [BR:rso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RSc2628 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: CAD16335
UniProt: Q8XW47
Position
2831376..2831885
Genome map
AA seq 169 aa AA seqDB search
MTVAYIGIGANLGDARQAVKDAVVCLAQQVGISITGKSSLYRSAPVDATGDDYINAVVRI
DTHFTAGQLLRICHHIEDQFGRERPFRNAPRTLDLDLLLYGDQTLTSPELTVPHPRVGQR
AFTLLPLHELAPDLVIPGIGAVAALLPGVADQVIEKMTLCQCMRAKPAA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatatcggcatcggcgccaacctcggcgacgcgcgccaggccgtcaaa
gacgccgtggtctgcctcgcgcagcaggtgggcatcagcatcaccggcaagtccagcctg
taccgcagtgccccggtggacgccaccggcgacgactacatcaatgccgtggtgcgcatc
gatacgcacttcaccgccggccagctgctgcgcatctgccaccatatcgaagaccagttc
ggccgcgaacgcccgttccgcaacgcaccgcgcacgctggacctggacctgctgctgtac
ggcgaccagaccctcacctcgcccgagctgaccgtgccgcatccgcgcgtcggacagcgt
gcctttaccctgctgccgctgcacgaactggcgccggatctcgtcatccccggcatcggc
gccgtggcggcactgctgccgggcgtcgccgaccaggtcatcgagaagatgacgctgtgc
cagtgcatgcgcgccaagccggccgcctga

DBGET integrated database retrieval system