KEGG   Ralstonia solanacearum GMI1000: RSc2628Help
Entry
RSc2628           CDS       T00071                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rso00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2831376..2831885
Genome map
AA seq 169 aa AA seqDB search
MTVAYIGIGANLGDARQAVKDAVVCLAQQVGISITGKSSLYRSAPVDATGDDYINAVVRI
DTHFTAGQLLRICHHIEDQFGRERPFRNAPRTLDLDLLLYGDQTLTSPELTVPHPRVGQR
AFTLLPLHELAPDLVIPGIGAVAALLPGVADQVIEKMTLCQCMRAKPAA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatatcggcatcggcgccaacctcggcgacgcgcgccaggccgtcaaa
gacgccgtggtctgcctcgcgcagcaggtgggcatcagcatcaccggcaagtccagcctg
taccgcagtgccccggtggacgccaccggcgacgactacatcaatgccgtggtgcgcatc
gatacgcacttcaccgccggccagctgctgcgcatctgccaccatatcgaagaccagttc
ggccgcgaacgcccgttccgcaacgcaccgcgcacgctggacctggacctgctgctgtac
ggcgaccagaccctcacctcgcccgagctgaccgtgccgcatccgcgcgtcggacagcgt
gcctttaccctgctgccgctgcacgaactggcgccggatctcgtcatccccggcatcggc
gccgtggcggcactgctgccgggcgtcgccgaccaggtcatcgagaagatgacgctgtgc
cagtgcatgcgcgccaagccggccgcctga

DBGET integrated database retrieval system