KEGG   Ralstonia solanacearum GMI1000: RSc2674Help
Entry
RSc2674           CDS       T00071                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RSc2674
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RSc2674
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RSc2674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2882600..2883097)
Genome map
AA seq 165 aa AA seqDB search
MSDIYAFEADSLAGQRVPLSQYRGKVLLIVNTASQCGFTPQYAGLEAVYKRLNEKGLEVL
GFPCNQFGKQEPGGAEEIGAFCEKNYGVSFPMFGKIEVNGSNAHPLYKWLTSEKPGVLGT
EAIKWNFTKFLLRRDGTVYKRYAPLTKPEEMLGDIETLLAEPDPL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatctacgcgttcgaggcggattcactggcaggccagcgcgtgccgctgtcg
cagtatcgcggcaaggtcctgctgatcgtcaacacggcgagccagtgcgggttcacgccg
caatacgccggcctggaagcggtgtacaagcggctgaacgaaaaggggctggaggtcctc
ggctttccgtgcaaccagttcggcaagcaggagccgggcggggcggaggagatcggcgcg
ttctgcgagaagaactacggggtatcgttccccatgttcggcaagatcgaggtgaacggg
tcgaacgcgcatccgctgtacaagtggctgacctcggagaagcccggcgtgctgggcacg
gaagccatcaagtggaacttcaccaagtttctgctgcgccgcgacggcacggtctacaag
cgctacgcgccgctgaccaagcccgaggagatgctcggcgatatcgagacgctgctggcg
gagccggatccgctttga

DBGET integrated database retrieval system