KEGG   Ralstonia solanacearum GMI1000: RSc2674Help
Entry
RSc2674           CDS       T00071                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rso00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rso00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2882600..2883097)
Genome map
AA seq 165 aa AA seqDB search
MSDIYAFEADSLAGQRVPLSQYRGKVLLIVNTASQCGFTPQYAGLEAVYKRLNEKGLEVL
GFPCNQFGKQEPGGAEEIGAFCEKNYGVSFPMFGKIEVNGSNAHPLYKWLTSEKPGVLGT
EAIKWNFTKFLLRRDGTVYKRYAPLTKPEEMLGDIETLLAEPDPL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatctacgcgttcgaggcggattcactggcaggccagcgcgtgccgctgtcg
cagtatcgcggcaaggtcctgctgatcgtcaacacggcgagccagtgcgggttcacgccg
caatacgccggcctggaagcggtgtacaagcggctgaacgaaaaggggctggaggtcctc
ggctttccgtgcaaccagttcggcaagcaggagccgggcggggcggaggagatcggcgcg
ttctgcgagaagaactacggggtatcgttccccatgttcggcaagatcgaggtgaacggg
tcgaacgcgcatccgctgtacaagtggctgacctcggagaagcccggcgtgctgggcacg
gaagccatcaagtggaacttcaccaagtttctgctgcgccgcgacggcacggtctacaag
cgctacgcgccgctgaccaagcccgaggagatgctcggcgatatcgagacgctgctggcg
gagccggatccgctttga

DBGET integrated database retrieval system