KEGG   Ralstonia solanacearum GMI1000: RSc2766Help
Entry
RSc2766           CDS       T00071                                 

Definition
guanyl-specific ribonuclease signal peptide protein (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rso  Ralstonia solanacearum GMI1000
Brite
Enzymes [BR:rso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     RSc2766
Transfer RNA biogenesis [BR:rso03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    RSc2766
 Prokaryotic Type
    RSc2766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2976770..2977201)
Genome map
AA seq 143 aa AA seqDB search
MTKRLGAWIGRSVSQAMVRGALAAMLALSVAGLPTAAAARDTTGMSAAVGTIPAVDLPNE
AQRTLVQIEQGGPFPYAKDGTTFGNYEGRLPARKRGYYREYTVKTRGARNRGARRIICGG
DQRAANDCYYTEDHYNSFQRIQR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcgacttggggcgtggatcggccgctccgtatctcaggcgatggtgcggggc
gcgctggcggcgatgcttgcgctgtcggtcgccgggctgccaacggcggcggccgcccgg
gacaccaccggcatgtcggcggcggtgggaaccattcccgcggtggacctgcccaatgaa
gcgcagcgcacgctggtacagatcgagcagggtggtccgtttccttatgcgaaagatggc
accacgtttggcaattatgaaggccgtttgccggcacgaaagcgtggctactaccgcgag
tacaccgtgaagacgcgcggtgcgcgcaatcgtggcgccagacgcatcatctgcggcggc
gaccagcgcgcggccaacgattgctactacacggaagatcactacaacagctttcaacgg
atacagcgatga

DBGET integrated database retrieval system