KEGG   Ralstonia solanacearum GMI1000: RSc2892Help
Entry
RSc2892           CDS       T00071                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rso  Ralstonia solanacearum GMI1000
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3120920..3121666)
Genome map
AA seq 248 aa AA seqDB search
MSFRIRVAAIASAALVVAMGAGYALTAGAAEPALDKVKASVQKALGSNVEIKGVAKSPLP
GLYEVNLGSQVVYTDATGRYVLNGDLLDTQTATNLTQERMAEINRIKWSDLPLDRAVKWV
KGNGARKVAVFSDPNCPYCHKLEQMFSQVDNITVYTFLFPILSEDSNTKAKQIWCASDRA
KAWRDWMVSKSAPGGAGNCDTPLEDNLKLGRALNVNGTPAIIFMDGSRAPGLIDAATLER
KFASLKKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcgtattcgggtggcggccatcgcctcggcggcgctggttgtcgccatgggc
gcgggctacgcgctgaccgccggtgccgccgagcccgcgctggacaaggtcaaggcctcg
gtgcagaaggcgctgggatcgaacgtcgagatcaagggcgtggccaagtcgccgctgccg
gggctgtacgaggtgaatctcggcagtcaggtcgtctacacggatgccaccggccgctat
gtgctcaacggcgacctgctcgatacgcagactgcgaccaacctcacgcaggagcgcatg
gccgagatcaaccgcatcaagtggtccgacctgccgctggatcgcgcggtgaagtgggtc
aagggcaacggcgcgcgcaaggttgccgtgttctccgacccgaactgcccgtactgccac
aagctggagcagatgttctcgcaggtcgacaacatcacggtctacaccttcctgttcccg
atcctgtccgaggactccaacaccaaggccaagcagatctggtgcgcgtctgaccgtgcc
aaggcctggcgcgactggatggtgtccaagagcgccccgggcggtgccggcaattgcgac
acgccgctggaagacaacctcaagctgggccgcgcgctcaacgtcaacggcaccccggcc
atcatcttcatggacggctcgcgggcgccgggcctgatcgatgcggccacgctggaacgc
aagttcgcgtcgctgaagaagtcgtga

DBGET integrated database retrieval system