KEGG   Ralstonia solanacearum GMI1000: RSc2936Help
Entry
RSc2936           CDS       T00071                                 

Definition
transmembrane sensor kinase transcription regulator protein (EC:2.7.3.-)
Orthology
K07649  
two-component system, OmpR family, sensor histidine kinase TctE [EC:2.7.13.3]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Two-component system
Module
TctE-TctD (tricarboxylic acid transport) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rso02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3167052..3168554
Genome map
AA seq 500 aa AA seqDB search
MTRRFALLPRSLKLTLLWLLLPGLVGVLAIDTLSAYQSLRTATDRAYDRALLGSVRAIEN
GVTIERGQVQVNVPYVALSMFESTAQSNVYYRVAYEQAAGAAALTGYADLPLPAGALDND
TPRFYDTLYHGEPVRIAAVAKPLYQPGLPARIVIQVAETIETRRALQQAVWRGMLARDAA
LVAISVALLWLGVTLALRPLKRLARGIAARASDDLRPLDATDVPAEVRPLVQAINHHIHR
YAELAAAQSQFLADASHQLRTPLAVLLTQAEYALRETDPVRVREGLAAIIARLQSTNRLT
SQLLALARARHAGQDAPPETFDLGELARSVVVDALPLAREKQQDLGWDDSGLAAALPVSG
YPAFLREALSNLVHNAIRYTPPGGRITVRAIKDSDAALVCVDDTGPGMNAVERAHAFERF
RRAHEGGTLPGGPKDARYAAEGSGLGLAIARAYAARSGGRIELADGEPNSRGGVGLSARI
RVPLTRTATGTQHAATQQVQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgacgctttgccctgctgccgcgcagcctcaagctgacgctgctgtggctcctg
ctgccggggctggtcggcgtgctggcgatcgatacgctgtcggcgtaccagtcgctgcgc
acggcgaccgaccgcgcctatgaccgcgcgctgctcggctcggtgcgcgccatcgagaac
ggcgtgacgatcgagcgcgggcaggtgcaggtcaacgtgccatacgtcgcgctgtcgatg
ttcgagtcgaccgcgcagagcaacgtgtactaccgggtcgcctacgaacaggcggccggg
gcggcggccctcaccggctacgccgacctgccgctgccggccggcgcgctcgacaacgac
acgccccgcttctacgacacgctataccacggcgagccggtacggatcgcggccgtggcc
aagccgctgtaccagccggggctgccggcgcgcatcgtgatccaggtggccgagaccatc
gagacgcggcgcgcgctgcagcaagcggtgtggcgtggcatgctggcccgcgatgcggcg
ctggtggcgataagcgtggcgctgctgtggctgggcgtgacgttggcgctgcggccgctc
aagcggctagcacgcggcattgccgcgcgcgcctccgatgacctgcgcccgctcgacgcc
accgacgtgccggccgaagtgcggccgctggtgcaggcgatcaatcaccacatccatcgc
tatgccgaactggcggcggcgcagagccagttcctggccgatgcgtcgcaccagctgcgc
acgccgctggcggtgctgctgacccaggccgagtacgcactgcgcgagaccgatccggtg
cgggtgcgcgagggcctggccgccatcatcgcgcggctgcagtccaccaatcgcctgacc
tcccagttgctggcgctggcgcgtgcccgccacgccggccaggatgcgccgcccgagacc
ttcgatctgggcgagctcgcgcgcagcgtggtggtcgatgcgctaccgctggcgcgcgaa
aagcagcaggacctgggctgggacgacagcggactggccgcggcgctgccggtgtcgggc
tatccggcgttcctgcgcgaggcgctgtccaacctcgtgcacaacgccatccgctatacg
ccgccgggcggccgcatcaccgtgcgcgccatcaaggacagcgacgccgcactcgtttgc
gtggacgacacgggccccggcatgaatgccgtggaacgtgcccatgccttcgagcgcttc
cgccgcgcgcacgagggcgggacgctgccgggcggccccaaggatgcgcgctatgccgcc
gaaggctcggggctggggctggccatcgcgcgcgcctatgccgcccgcagcggtgggcgg
atcgagctggccgacggcgagccgaacagccgtggcggcgtggggctttccgcccggatc
cgggtaccgctgacaaggaccgccaccggcactcagcatgctgcgacgcagcaggtgcaa
tga

DBGET integrated database retrieval system