KEGG   Ralstonia solanacearum GMI1000: RSc2936Help
Entry
RSc2936           CDS       T00071                                 

Definition
transmembrane sensor kinase transcription regulator protein (EC:2.7.3.-)
Orthology
K07649  
two-component system, OmpR family, sensor histidine kinase TctE [EC:2.7.13.3]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Two-component system
Module
TctE-TctD (tricarboxylic acid transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:rso00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSc2936
Enzymes [BR:rso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     RSc2936
Protein kinases [BR:rso01001]
 Histidine protein kinases
  OmpR family
   RSc2936
Two-component system [BR:rso02022]
 OmpR family
  TctE-TctD [MD:M00457]
   RSc2936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3167052..3168554
Genome map
AA seq 500 aa AA seqDB search
MTRRFALLPRSLKLTLLWLLLPGLVGVLAIDTLSAYQSLRTATDRAYDRALLGSVRAIEN
GVTIERGQVQVNVPYVALSMFESTAQSNVYYRVAYEQAAGAAALTGYADLPLPAGALDND
TPRFYDTLYHGEPVRIAAVAKPLYQPGLPARIVIQVAETIETRRALQQAVWRGMLARDAA
LVAISVALLWLGVTLALRPLKRLARGIAARASDDLRPLDATDVPAEVRPLVQAINHHIHR
YAELAAAQSQFLADASHQLRTPLAVLLTQAEYALRETDPVRVREGLAAIIARLQSTNRLT
SQLLALARARHAGQDAPPETFDLGELARSVVVDALPLAREKQQDLGWDDSGLAAALPVSG
YPAFLREALSNLVHNAIRYTPPGGRITVRAIKDSDAALVCVDDTGPGMNAVERAHAFERF
RRAHEGGTLPGGPKDARYAAEGSGLGLAIARAYAARSGGRIELADGEPNSRGGVGLSARI
RVPLTRTATGTQHAATQQVQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgacgctttgccctgctgccgcgcagcctcaagctgacgctgctgtggctcctg
ctgccggggctggtcggcgtgctggcgatcgatacgctgtcggcgtaccagtcgctgcgc
acggcgaccgaccgcgcctatgaccgcgcgctgctcggctcggtgcgcgccatcgagaac
ggcgtgacgatcgagcgcgggcaggtgcaggtcaacgtgccatacgtcgcgctgtcgatg
ttcgagtcgaccgcgcagagcaacgtgtactaccgggtcgcctacgaacaggcggccggg
gcggcggccctcaccggctacgccgacctgccgctgccggccggcgcgctcgacaacgac
acgccccgcttctacgacacgctataccacggcgagccggtacggatcgcggccgtggcc
aagccgctgtaccagccggggctgccggcgcgcatcgtgatccaggtggccgagaccatc
gagacgcggcgcgcgctgcagcaagcggtgtggcgtggcatgctggcccgcgatgcggcg
ctggtggcgataagcgtggcgctgctgtggctgggcgtgacgttggcgctgcggccgctc
aagcggctagcacgcggcattgccgcgcgcgcctccgatgacctgcgcccgctcgacgcc
accgacgtgccggccgaagtgcggccgctggtgcaggcgatcaatcaccacatccatcgc
tatgccgaactggcggcggcgcagagccagttcctggccgatgcgtcgcaccagctgcgc
acgccgctggcggtgctgctgacccaggccgagtacgcactgcgcgagaccgatccggtg
cgggtgcgcgagggcctggccgccatcatcgcgcggctgcagtccaccaatcgcctgacc
tcccagttgctggcgctggcgcgtgcccgccacgccggccaggatgcgccgcccgagacc
ttcgatctgggcgagctcgcgcgcagcgtggtggtcgatgcgctaccgctggcgcgcgaa
aagcagcaggacctgggctgggacgacagcggactggccgcggcgctgccggtgtcgggc
tatccggcgttcctgcgcgaggcgctgtccaacctcgtgcacaacgccatccgctatacg
ccgccgggcggccgcatcaccgtgcgcgccatcaaggacagcgacgccgcactcgtttgc
gtggacgacacgggccccggcatgaatgccgtggaacgtgcccatgccttcgagcgcttc
cgccgcgcgcacgagggcgggacgctgccgggcggccccaaggatgcgcgctatgccgcc
gaaggctcggggctggggctggccatcgcgcgcgcctatgccgcccgcagcggtgggcgg
atcgagctggccgacggcgagccgaacagccgtggcggcgtggggctttccgcccggatc
cgggtaccgctgacaaggaccgccaccggcactcagcatgctgcgacgcagcaggtgcaa
tga

DBGET integrated database retrieval system