KEGG   Ralstonia solanacearum GMI1000: RSc3052Help
Entry
RSc3052           CDS       T00071                                 

Gene name
glpK
Definition
ATP:glycerol 3-phosphotransferase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RSc3052 (glpK)
Enzymes [BR:rso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RSc3052 (glpK)
Exosome [BR:rso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSc3052 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3289517..3291013
Genome map
AA seq 498 aa AA seqDB search
MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEHDPLDIWSSQLATCRA
ALEQARLGAADMAALGITNQRETTVVWERATGRPIFNAIVWQDRRTEAICERLRAEGLED
EVRKRTGLVIDPYFSGTKLRWILDHVDGARERAARGELAFGTIDSWLVWQLTRGRLHVTD
VSNASRTLLWNIHTGQWDADLMRALDIHPSLLPEVHPSAHRFGQTDADWLGAPLTIGGIA
GDQQSALFGQACFKPGMAKNTYGTGCFMLLNTGERAVESRNGLISTAACQSGSRRSYALE
GSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVVFVPSFTGLGAPYWDPTAQGA
IVGLSRGTTIGHIARAALESIAFQSTALLQAMTRDAVSAITELRVDGGASANNLLLQFQA
DLLGIPVVRPEIIETTALGAAYLAGIATGFYRSEDEVARQWRASRTFHPVISRDEAQHRM
AQWEMAVAQVRLPTTHGH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaatacctcctcgcgctcgaccagggcacgtccagttcgcgtgccatcgtgttcaac
cgcgccggccagatcgtcgccagcgcccagcaggagtttccgcagcattttccgcagccc
ggctgggtcgagcacgatccgctcgacatctggagcagccagctcgccacctgccgcgcc
gcgctcgaacaagccaggctgggcgccgccgacatggccgcgctcggcatcaccaaccag
cgcgagaccaccgtggtgtgggaacgcgccaccggccgccccatcttcaatgccatcgtc
tggcaggaccgccgcaccgaggcgatctgcgagcggctgcgcgccgagggcctggaggac
gaggtgcgcaagcgcaccgggctggtgatcgatccgtatttctcgggcaccaagctgcgc
tggatcctcgaccacgtggacggtgcccgcgaacgcgccgcgcgcggcgagctcgccttc
ggcaccatcgacagctggctggtgtggcaactcacgcgcggccgcctgcacgtgaccgac
gtatccaacgcctcgcgcaccctgctgtggaacatccacaccggccagtgggatgccgac
ctgatgcgcgcgctcgacatccacccgagcctgctgccggaggtgcacccgtcggcccat
cgcttcgggcagaccgatgccgactggctgggcgcgccgctcaccatcggcggcatcgcc
ggcgaccagcagtcggcgctgttcggccaggcctgcttcaagcctggcatggccaagaac
acctacggcaccggctgcttcatgctgctcaacaccggcgagcgcgcggtcgaatcgcgc
aatgggctgatcagcacggcggcctgccagagcggcagccggcgcagctacgcgctggaa
ggcagcgtgttcgtcggcggcgcggtggtgcagtggctgcgcgacgggctgcgcgcgatc
cagcgctcggccgacgtggaggggctcgccgcctcggtgccggattcgggcggcgtggtg
ttcgtgccctcgttcaccggactgggggcgccgtactgggacccgaccgcgcagggcgcg
atcgtcgggctgtcgcgcggcacgaccatcggccatatcgcgcgggcggcgctggagtcg
atcgcgttccagagcaccgcgctgctgcaggcgatgacgcgcgacgcggtctcggccatc
acggagctgcgcgtggacggcggcgcctcagccaacaacctgctgctgcagttccaggcc
gacctgctcggcatcccggtggtgcgcccggagatcatcgaaaccacggcgctgggcgcg
gcctacctggccggcatcgccaccggcttctaccggagcgaggacgaggtcgcccggcaa
tggcgcgcctcgcgcacgttccacccggtcatcagccgcgacgaagcgcagcaccgcatg
gcgcaatgggagatggcggtggcgcaggtgcggctgccgaccacgcacggccactga

DBGET integrated database retrieval system