KEGG   Ralstonia solanacearum GMI1000: RSc3130Help
Entry
RSc3130           CDS       T00071                                 

Gene name
adhA
Definition
propanol-preferring alcohol dehydrogenase oxidoreductase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RSc3130 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSc3130 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    RSc3130 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSc3130 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSc3130 (adhA)
   00626 Naphthalene degradation
    RSc3130 (adhA)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSc3130 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3376654..3377679
Genome map
AA seq 341 aa AA seqDB search
MARSMKAAVVHAFGEPLRIEDVPIPTPGRGQILVNIRASGVCHTDLHAADGDWPVKPRLP
FIPGHEGVGFVAAVGEGVTAVKEGDRVGVPWLYTACGHCEHCLGGWETLCHDQQNTGYSV
NGGYAEYVLADPNYVGHLPAQVGFEEIAPILCAGVTVYKGIRMTDTRPGQWIAISGIGGL
GHVAVQYAVAMGLHVVAVDVAPEKLALARELGARLSVDASQQDPAAVIQKEVGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
QFAAEGQVRAHIHRDRLDNINQVLADLKAGKVDGRIVLSLD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtcgatgaaagccgctgtcgtgcacgcgttcggcgaaccgctgcgcatcgag
gacgtcccgatcccgacgccgggccgcggacagatcctcgtcaacatccgggcttccggg
gtctgccacaccgacctgcacgccgccgacggcgactggccggtcaagccgcgcctgccg
ttcatccccgggcacgagggcgtgggcttcgtggcggcggtgggcgaaggcgtcaccgcc
gtcaaggaaggcgaccgcgtgggcgtgccctggctctacaccgcctgcggccactgcgaa
cactgcctgggcggctgggaaaccctgtgccacgaccagcagaacactggctactccgtc
aacggcggctacgccgaatacgtgctggccgaccccaactatgtcggccacctgccggcg
caggtcggcttcgaggagatcgcacccatcctgtgcgcgggcgtgacggtctacaagggc
atccgcatgaccgacacccgccccggccagtggatcgccatctcgggcatcggcgggctg
gggcatgtggcggtgcagtatgccgtcgccatggggctgcacgtggtggcggtggatgtc
gcccccgagaagctggcgctggcgcgcgaactgggcgcccggctgagcgtcgatgcctcg
cagcaggacccggccgctgtcatccagaaggaggtgggcggcgtgcacggcgtgctggtg
acggcggtctcgcgcagcgccttcgcccaggccctgggcatggtgcgacgcggcggcacc
gtctcgctcaacggattgccgccgggcgactttccgctgccgatcttctcgaccgtgctc
aacggcatcacggtgcgcggctccatcgtcggcacgcggcgcgatctgcaggagtcgctg
cagttcgccgccgaggggcaggtgcgcgctcacatccatcgcgaccggctcgacaacatc
aaccaggtcctcgccgacctgaaagccggcaaggtggacggccgcatcgtcctctcgctg
gactga

DBGET integrated database retrieval system