KEGG   Ralstonia solanacearum GMI1000: RSc3192Help
Entry
RSc3192           CDS       T00071                                 

Definition
lysozyme (endolysin) protein (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rso  Ralstonia solanacearum GMI1000
Brite
Enzymes [BR:rso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     RSc3192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3456925..3457386)
Genome map
AA seq 153 aa AA seqDB search
MTNIPLPAIELAKHFEGFHRVARVDPTRAQPYVCPAGFWTVGYGHLCDPTHPPITQAQAE
VYLAADLVTALNATLRYCPVLAAEPQGRLAAIVDFTFNLGAGRLQTSTLRRRVNQRDWSA
AASELRRWVYGGGKVLPGLAARREAEVALLRLN
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaacatcccactaccggccatcgaactggccaagcatttcgagggatttcatagg
gtggcgagggtcgaccccacccgggctcagccgtatgtctgtcctgccgggttttggaca
gttggctacggtcacctttgcgatccgacgcacccgcccatcacgcaggcccaggccgaa
gtctatctggcggcggatctcgtgacagcgctcaacgcgacgctgcgctactgccccgtg
cttgccgccgagccccagggccggctcgccgccattgtggacttcaccttcaacctgggg
gcggggcggttgcagacttcgaccttgcggcggcgggtcaaccagcgcgactggtccgct
gctgcaagcgagctgcgccgctgggtctatggtggcggcaaggtgctgccggggctcgcc
gcacgtcgcgaggcagaagtggctttattgcgattgaactga

DBGET integrated database retrieval system