KEGG   Ralstonia solanacearum GMI1000: RSc3442Help
Entry
RSc3442           CDS       T00071                                 

Gene name
dnaA
Definition
(GenBank) probable chromosomal replication initiator protein dnaa.
  KO
K02313  
chromosomal replication initiator protein
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:rso00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSc3442 (dnaA)
DNA replication proteins [BR:rso03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    RSc3442 (dnaA)
Chromosome [BR:rso03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    RSc3442 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3714708..3716276)
Genome map
AA seq 522 aa AA seqDB search
MQDFWHAASAQLESELTPQQFKTWIKPLTPLSFDEQACMLRIAAPNRFKLDWVKSQFSGR
IQSLACDYWEMQVDVQFVLDPTAGQRQAAMQPALAPMPMQPLAAQTMQAQAVPREAPARP
TMAPYRETPMATAAHAAADIDVPVMDAAEASTQSYRVPAPAAPAVMGGLSAPPAAPVDDT
VHERSRLNPILTFDNLVTGKANQLARAAAVQVANNPGKSYNPLYLYGGVGLGKTHLIHAI
GNFMLMENPRARIRYIHAEQYVSDVVKAYQRKAFDDFKRYYHSLDLLLIDDIQFFSGKNR
TQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAI
LMKKAQAENVTVPEEVAFFVAKHLRSNVRELEGALRKILAYSNFHGKEITIEVTREALKD
LLTVQNRQISVENIQKTCADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEI
GELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTLKG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatttttggcatgcggcgtccgcccagctcgagagcgagctgactccgcaacaa
ttcaagacgtggatcaagccgctgacgccgctgtcattcgacgagcaggcgtgcatgctg
cggattgccgcgcctaaccgtttcaagctcgactgggtcaagagccagttttcgggccgc
attcagtcgctcgcgtgcgactactgggagatgcaggtcgacgtgcagttcgtgctcgac
ccgaccgccggccagcgccaggccgccatgcagccggcactggccccgatgccgatgcag
ccgctggctgcgcaaacgatgcaggcccaggctgtgccgcgcgaagcgccggcccgcccc
acaatggcgccctaccgcgaaaccccgatggccacggccgcccatgcggcggccgacatc
gacgtgcccgtcatggacgccgccgaggccagcacccagtcgtaccgcgtgccggcaccg
gccgcacccgccgtgatgggtggcctgagcgcaccgcccgccgccccggtggatgacacc
gtgcacgagcgctcacggctgaaccccatcctcaccttcgacaacctcgtcaccggcaag
gccaaccagttggcgcgcgcggccgccgtgcaggtcgccaacaacccgggcaagtcgtac
aacccgctgtacctgtacggcggggtggggctgggcaagacccacttgatccatgccatc
ggcaacttcatgctgatggagaacccgcgcgcgcgtatccgctacatccacgcagaacag
tacgtttccgacgtagtgaaggcttaccagcgcaaggcgttcgacgacttcaagcgctac
taccactcgctggacctgctgctgatcgacgacatccagttcttctcgggcaagaaccgc
acgcaggaagaattcttctatgcgttcgaggcgctgatcgccaaccgcgcgcaggtcatc
atcaccagcgacacgtacccgaaggagatcaccggcatcgatgaccggctgatctcgcgc
ttcgactccggcctgacggtggccatcgagccgcccgagctggagatgcgcgtcgccatc
ctgatgaagaaggcgcaggccgagaacgtgacggtgccggaggaggtggccttcttcgtg
gccaagcacctgcgctcgaacgtgcgcgagctggaaggcgcgctgcgcaagatcctggcg
tactcgaacttccacggcaaggagatcaccatcgaggtcacgcgcgaggcgctcaaggat
ctgctcacggtgcagaaccggcagatctcggtggagaacatccagaagacctgcgcggac
ttctacaacatcaaggtcgccgacatgtattccaagaagcggccggccaacatcgcgcgc
ccgcgccagatcgccatgtacctggccaaggagctgacgcagaagagcctgccggagatc
ggcgagctgttcggcggacgcgaccacaccacggtgctgcacgcggtacgcaagatcgcc
gacgagcgcagcaaggacgcccagctcaaccacgagctgcacgtgctggagcagacgctg
aagggctga

DBGET integrated database retrieval system