KEGG   Ralstonia solanacearum GMI1000: RSp0006Help
Entry
RSp0006           CDS       T00071                                 

Gene name
galU2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rso00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rso00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rso00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rso00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:6803..7768
Genome map
AA seq 321 aa AA seqDB search
MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFITGR
AKRAIEDHFDKAYELESELAAKNKHALLEMVQSIKPAGVECFYVRQPETLGLGHAVLCAQ
KLVRDEPFAVILADDLLDHEPSVMQQMTELYDHYRCSIVGVETIAPQASRSYGVVAGREW
DDRLIKLDGIVEKPAPEHAPSNLGVVGRYILTPRIFDHLRNLAPGTGGEIQLTDAIQRLM
AEEQILAYRYRGQRFDCGSKFGYLQATVELALRHPEVGADFEAYLYARMGLPHELPAAVE
APASTVTPVSKKVLPLEGVAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagatcaccaaggccgtgtttcccgtggcggggctcggcacgcgtttcttg
cccgccacgaaagccagcccgaaggaaatgctgcccatcgtggacaagccgctgatccag
tatgcggtggaggaagccgcagcagcaggcattaccgagatgatcttcattacggggcgc
gccaagcgcgcgatcgaagaccatttcgacaaggcctacgaactggagtccgaactggct
gcgaagaacaagcacgcgttgctcgagatggtccagtccatcaagccggctggcgtcgaa
tgtttctacgtgcgccagccggagacgctgggcctgggccacgctgtgctgtgtgcgcag
aaattggtacgcgacgagccgttcgccgtgatcctggcggacgatctgctggaccatgag
ccgtcggtcatgcagcagatgacggagctctatgaccactaccgctgttcgatcgtcggg
gtggagaccatcgcgccgcaggcgtcgcgttcctacggcgtggtggcggggcgcgaatgg
gacgatcgactgatcaagctggatggcatcgtcgaaaagccggcgccggagcacgcgcca
tccaatctcggcgtggttggccgctacatcctgacgccgcgcatcttcgatcatctgcgc
aatctcgcgcccggtacgggcggcgagatccagctgacggacgcgatccagcgcctgatg
gccgaggagcagatcctggcgtaccgctatcgcgggcagcgtttcgattgcggcagcaag
ttcggctatctacaggccactgtcgagctggcgctgcgccatccggaggtcggtgccgac
ttcgaggcgtatctgtatgcgcggatgggcctgccgcatgagttgcccgctgccgtggag
gcacccgcgagtaccgtcaccccggtcagcaagaaagtgttgccgctggagggggtggct
gcctga

DBGET integrated database retrieval system