KEGG   Ralstonia solanacearum GMI1000: RSp0006Help
Entry
RSp0006           CDS       T00071                                 

Gene name
galU2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RSp0006 (galU2)
   00052 Galactose metabolism
    RSp0006 (galU2)
   00500 Starch and sucrose metabolism
    RSp0006 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    RSp0006 (galU2)
Enzymes [BR:rso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RSp0006 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:6803..7768
Genome map
AA seq 321 aa AA seqDB search
MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFITGR
AKRAIEDHFDKAYELESELAAKNKHALLEMVQSIKPAGVECFYVRQPETLGLGHAVLCAQ
KLVRDEPFAVILADDLLDHEPSVMQQMTELYDHYRCSIVGVETIAPQASRSYGVVAGREW
DDRLIKLDGIVEKPAPEHAPSNLGVVGRYILTPRIFDHLRNLAPGTGGEIQLTDAIQRLM
AEEQILAYRYRGQRFDCGSKFGYLQATVELALRHPEVGADFEAYLYARMGLPHELPAAVE
APASTVTPVSKKVLPLEGVAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagatcaccaaggccgtgtttcccgtggcggggctcggcacgcgtttcttg
cccgccacgaaagccagcccgaaggaaatgctgcccatcgtggacaagccgctgatccag
tatgcggtggaggaagccgcagcagcaggcattaccgagatgatcttcattacggggcgc
gccaagcgcgcgatcgaagaccatttcgacaaggcctacgaactggagtccgaactggct
gcgaagaacaagcacgcgttgctcgagatggtccagtccatcaagccggctggcgtcgaa
tgtttctacgtgcgccagccggagacgctgggcctgggccacgctgtgctgtgtgcgcag
aaattggtacgcgacgagccgttcgccgtgatcctggcggacgatctgctggaccatgag
ccgtcggtcatgcagcagatgacggagctctatgaccactaccgctgttcgatcgtcggg
gtggagaccatcgcgccgcaggcgtcgcgttcctacggcgtggtggcggggcgcgaatgg
gacgatcgactgatcaagctggatggcatcgtcgaaaagccggcgccggagcacgcgcca
tccaatctcggcgtggttggccgctacatcctgacgccgcgcatcttcgatcatctgcgc
aatctcgcgcccggtacgggcggcgagatccagctgacggacgcgatccagcgcctgatg
gccgaggagcagatcctggcgtaccgctatcgcgggcagcgtttcgattgcggcagcaag
ttcggctatctacaggccactgtcgagctggcgctgcgccatccggaggtcggtgccgac
ttcgaggcgtatctgtatgcgcggatgggcctgccgcatgagttgcccgctgccgtggag
gcacccgcgagtaccgtcaccccggtcagcaagaaagtgttgccgctggagggggtggct
gcctga

DBGET integrated database retrieval system