KEGG   Ralstonia solanacearum GMI1000: RSp0138Help
Entry
RSp0138           CDS       T00071                                 

Gene name
pme
Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RSp0138 (pme)
   00500 Starch and sucrose metabolism
    RSp0138 (pme)
Enzymes [BR:rso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     RSp0138 (pme)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:complement(160019..161338)
Genome map
AA seq 439 aa AA seqDB search
MGTTPIRGAAVPYLRNAIAFHQLHIPIKQKSLTPGILLTGKITMQSKTLYLKATALLGGC
TVFAATALAVTSTATRPQLSSADARTYTIAKYLASFGTIGSLTTDNWDPTGGVGAVSGFR
ANYAVAADGTAQYKTVQAAIDAAVNAGGVARRYISVKAGIYNELVCVPESAPPITLYGLD
ANAGNTQIVYNNANPTPASGAKTNPCMGTSSNATVGTLRSATAMVRASDFHARNLTFKNS
YVEGTYADNNQSAVALAVRGDKAILENVSVIGNQDTLFVGATSTTTVIRAYFKNSFIQGD
TDFIFGAGTAVFHGCTIQYTAARLGAKAASYIFAPSTAPGNPYGFLAINSTFNATGNPPN
NSLHLGRAWDQSVSGTSAYINGSSPNGQVVIRDSSLGALIRLADPWGPSTAGRPYCSANC
AYSANRFFEYNNTGAGSGN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgaccccgatccgtggcgctgccgttccatacctgcgcaatgccatcgcattc
catcagttgcacatccctatcaaacaaaaaagcctgacaccaggcatccttttgaccgga
aaaataacgatgcaatccaaaaccctgtacttgaaagccaccgcattgctgggaggctgc
accgtgtttgccgcaacggcgctcgccgtgacaagcaccgccacccgccctcagctcagc
agtgccgacgcgcgcacctacaccatcgcgaaatacctggcgagcttcgggacgatcggc
tcgctgaccacggacaattgggaccccaccggcggcgtcggcgcggtgagcggcttccgg
gccaactacgcggtcgcggcggacggaacggcgcaatacaagacggtgcaggccgcgatc
gacgcggcagtcaacgccggcggcgtggcgcgcaggtacatcagcgtgaaggccggcatc
tacaacgaactggtctgcgtgcccgagtcggcgccgccgatcacgctgtatggcctcgat
gcgaacgccggcaacacgcagatcgtctacaacaacgcgaacccgacgcccgcctcgggc
gccaagacaaacccctgcatgggcaccagcagcaatgccacggtcggcacgctgcgcagc
gccaccgccatggtgcgggcatcggacttccacgcccgcaacctgaccttcaagaacagc
tacgtggaaggcacctatgccgacaacaaccagtccgcggtagcgcttgccgtgcgcggc
gacaaggccatcctcgaaaacgtctcggtcatcggcaaccaggacacgctgttcgtcggc
gccacgagcaccaccacggtgatccgcgcctacttcaagaacagcttcatccagggcgat
acggatttcatctttggtgccggcaccgccgtcttccatggctgcacgatccagtacacc
gcggcacgcctgggcgccaaggccgccagctacatctttgcgccgagcacggccccgggc
aatccgtacgggttcctcgccatcaacagcaccttcaacgccaccggcaatccgccgaac
aacagcctgcacctggggcgcgcgtgggatcagagcgtgagcggcacctcggcctacatc
aacggcagctcgcccaatgggcaggtggtgatccgcgattcgtcgctgggtgcgctgatc
cggctggccgatccgtggggcccatcgacggcggggcggccctactgttcggccaactgc
gcgtattcggcgaatcggttctttgagtacaacaacacgggggcgggtagcggcaactga

DBGET integrated database retrieval system