KEGG   Ralstonia solanacearum GMI1000: RSp0162Help
Entry
RSp0162           CDS       T00071                                 

Gene name
egl
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rso00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:188600..189862
Genome map
AA seq 420 aa AA seqDB search
MPLVAASMAALMLAGCGGGDGDTTLSTAAATDTTTLKTAATTSISPLWLTIAKDSAAFTV
SGTRTVRYGAGSAWVAKSMSGTGQCTAAFFGKDPAAGVAKVCQVAQGTGTLLWRGVSLAG
AEFGEGSLPGTYGSNYIYPSADSATYYKNKGMNLVRLPFRWERLQPTLNQALDANELSRL
TGFVNAVTAAGQTVLLDPHNYARYYGNVIGSSAVPNSAYADFWRRVATQFKGNARVIFGL
MNEPNSMPTEQWLSGANAALAAIRSANASNVVFVPGNAWTGAHSWNQNWYGTPNGTVMKG
INDPGRNLVFEVHQYLDGDSSGQSASCVSATIGAERLQDFTNWLRSNGYRGFLGEFGAAS
NDTCNQAVANMLTFVKNNADVWTGWAWWAGGPWWGGYMYSIEPSNGVDKPQMSVLAPYLK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggttgccgcttcgatggcggccctcatgcttgccggttgcggcggcggcgac
ggtgacaccaccctcagcacggcggccgctaccgacaccacgaccctgaagacggccgcc
accacctcgatctcgccgttgtggctcaccatcgccaaggacagcgcggcgttcacggtg
agcggcacgcgcacggtgcgctatggcgccggcagcgcgtgggtggcgaagagcatgtcc
ggcacaggccagtgcaccgccgccttcttcggcaaggatccggcggccggtgtcgccaag
gtatgccaggtggcgcagggcacgggcaccttgctgtggcgcggcgtcagcctggccggc
gccgagttcggggagggcagcctgccgggcacctacgggagcaactacatctatccgtcc
gccgacagcgcgacctactacaagaacaagggcatgaacctcgtgcgcctgccgttccgc
tgggagcggctgcagcccacgctcaaccaggcgctcgacgcgaacgagctgtcgcgcctg
accgggttcgtcaacgccgtgacggcggccggccagacggtgctgctcgatccgcacaac
tacgcgcgctactacggcaacgtgatcggctcgagcgcggtgcccaacagcgcgtacgcc
gatttctggcggcgcgtggccacccagttcaagggcaatgcccgcgtcatcttcgggctg
atgaacgagcccaattcgatgccgaccgagcagtggctgtccggcgccaacgccgcgctg
gccgcaatccgctcggccaatgcgagcaacgtggtgttcgtgcccggcaacgcctggacg
ggcgcgcacagctggaaccagaactggtacggcacgccgaacggcaccgtcatgaagggc
atcaatgacccgggccgcaacctcgtcttcgaggtgcaccagtacctggacggcgattcg
tccggccagtcggccagctgcgtgagcgccaccatcggcgccgagcggctgcaggacttc
accaactggctgcgcagcaacggctatcgcggcttcctgggcgagttcggcgcggcctcc
aacgacacctgcaaccaagcggttgccaacatgctcaccttcgtgaagaacaatgccgat
gtctggaccggctgggcgtggtgggcgggcggtccgtggtggggcggctacatgtactcg
atcgagccgtcgaacggcgtggacaagccgcagatgtcggtgctggcgccgtacctgaag
taa

DBGET integrated database retrieval system