KEGG   Ralstonia solanacearum GMI1000: RSp1143Help
Entry
RSp1143           CDS       T00071                                 

Gene name
glsA
Definition
(GenBank) probable glutaminase protein
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00220  Arginine biosynthesis
rso00250  Alanine, aspartate and glutamate metabolism
rso00471  D-Glutamine and D-glutamate metabolism
rso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RSp1143 (glsA)
   00220 Arginine biosynthesis
    RSp1143 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RSp1143 (glsA)
Enzymes [BR:rso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     RSp1143 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CAD18294
UniProt: Q8XQS6
Position
megaplasmid:1443367..1444281
Genome map
AA seq 304 aa AA seqDB search
MDYQAILETIHRDIQPWLGKGRVADYIPELAKASATDFGMAIVTPRGEVFRVGQAETLFS
IQSISKLFACTLAFQLEGESLWQRVGREPSGNAFNSLVQLEHENGIPRNPFINAGALVVT
DVLCRRFVQAETAMVQFMRRLVDNPRVDYNPRVALSELEHADRNRAMAHFMRSFGNLHMP
VETVIDAYCRQCAIEMHCVDLARAVLFLANGGVVPWSGERVIETSPAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEFGVCVWSPGLDVSGNSLAGLQALEWLTTLSG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggactaccaagcgatcctggaaaccatccaccgcgacatccagccctggctcggcaag
ggccgcgtggccgactacattcccgagctggccaaggccagcgccaccgatttcggcatg
gcgatcgtcacgccgcgcggcgaggtgttccgcgtcgggcaggccgagacgctgttctcc
atccagagcatttccaagctgttcgcgtgcaccctcgccttccagctcgagggcgaatcg
ctgtggcagcgggtcggccgcgagccgtccggcaacgccttcaactcgctggtgcagctg
gagcacgaaaacggcatcccgcgcaatccgttcatcaatgccggcgcgctggtggtgacg
gacgtgctgtgccggcgcttcgtgcaggccgagaccgccatggtgcagttcatgcggcgg
ctggtcgacaacccgcgcgtcgactacaacccgcgcgtggcgttgtccgagctcgagcac
gcggaccgcaaccgcgccatggcgcacttcatgcgcagcttcggcaacctgcacatgccg
gtcgaaacggtgatcgacgcctactgccggcagtgcgccatcgagatgcactgcgtggac
ctcgcccgcgccgtgctgttcctggccaacggcggcgtggtgccgtggagcggcgagcgc
gtgatcgagaccagtccggccaagcgcctgtccgcgctgatgctgacctgcggcacctac
gacgcggccggcgatttcgtctaccgggtcggcctgccggccaagagcggcgtgggcggc
gggatcgtcgcggtgctgccgggcgagttcggcgtgtgcgtgtggtcgccagggctggac
gtgagcggcaactcgctggccggcctgcaggcgctggagtggctgacgacgctcagcggc
cggtcgatcttctga

DBGET integrated database retrieval system