KEGG   Ralstonia solanacearum GMI1000: RSp1557Help
Entry
RSp1557           CDS       T00071                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSp1557 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSp1557 (glk)
   00052 Galactose metabolism
    RSp1557 (glk)
   00500 Starch and sucrose metabolism
    RSp1557 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RSp1557 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSp1557 (glk)
   00524 Butirosin and neomycin biosynthesis
    RSp1557 (glk)
Enzymes [BR:rso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RSp1557 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:complement(1958844..1959899)
Genome map
AA seq 351 aa AA seqDB search
MSIGLHEVGVGSMDDVTAYPRLVGDVGGTNARFALEMAPMRLAHIGVLAGDDYPSLEAAM
RAYLAALPPEIAAAGVRHAAIGIANPVLGDQIRMTNRDWAFSTEAMRQSLGFDTFVVLND
FAALAHALPYLGADELEQVGGSTCVADAPRALLGPGTGLGVASLLPTQAGRFIAVAGEGG
HVAFAPMNDEEVVIWRFARERFGHVSAERLISGMGLELIYEALGACFDLWQQGPAVRRAA
DITAIALGEMEDTAGDHARCRYAVDTFCAMLGTVAANLAVTLGARGGVYIGGGIVPRLGA
AFANSPFRRRFEDKGRFSGYVAAMPVYVIHAPYPGLIGLCAAMDHAVASGH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctattggtctgcatgaagtcggcgtgggcagcatggacgatgtgacggcctacccg
cgcctggtcggggatgtcggcgggaccaacgcgcgcttcgcgctggagatggcgccgatg
cggctggcccatatcggcgtgctggccggcgacgactacccgtcgctggaagcggccatg
cgcgcctatctcgccgcgctgccgccggagatcgccgcggcgggcgtgcggcatgcggcc
atcggcatcgccaatccggtgctgggcgaccagatccgcatgaccaaccgcgactgggcg
ttttccaccgaggcgatgcgccagtcgctgggcttcgataccttcgtcgtgctcaacgat
ttcgccgcgctggcgcacgcgctgccctacctgggcgccgacgagctggaacaggtgggc
ggcagcacctgcgtggccgacgcgccgcgcgcgctgctggggccgggcacgggcctgggc
gtggcgtcgctgctgccgacgcaggcagggcgcttcatcgccgtcgcgggcgaggggggc
cacgtcgcgtttgcgccgatgaacgacgaggaagtcgtcatctggcgcttcgcgcgcgag
cgcttcggccatgtctcggccgagcggctgatctcgggcatggggctggagctgatctac
gaggcgctcggcgcgtgcttcgacctgtggcagcagggccccgccgtgcgccgcgccgcc
gacatcaccgccatcgccctgggcgaaatggaagacaccgccggcgatcacgcccgctgc
cgctacgccgtcgatacgttctgcgccatgctcggcaccgtggcggccaacctggcggtc
acgctgggcgcgcggggcggggtctatatcggcggcggcatcgtgccgcggctgggcgcc
gccttcgccaattcaccgttccggcggcggttcgaagacaagggccgcttctccggctat
gtggcggcgatgccggtgtacgtcatccatgcgccgtacccggggctgatcggcctgtgc
gcggcgatggatcacgccgtggccagcggccactga

DBGET integrated database retrieval system