KEGG   Ralstonia solanacearum GMI1000: RSp1578Help
Entry
RSp1578           CDS       T00071                                 

Gene name
speB
Definition
(GenBank) probable agmatinase protein
  KO
K01480  
agmatinase [EC:3.5.3.11]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RSp1578 (speB)
Enzymes [BR:rso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RSp1578 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
megaplasmid:1980687..1981643
Genome map
AA seq 318 aa AA seqDB search
MSTYTTAPRTGHQTLLYAELDTDLDNLQADIAVLGMPFGTPYSAADFSNDQTNAPAAIRQ
ATDRVARAPGHYDFDIDGPLLQGRDDIRFVDCGDIVPDLAQPPGEHYARAEAAVRRLANA
GALPIVLGGDHGITTPILRGLDQKGPITLVHIDAHLDWRDSVNGVKEGLSSPMRRASEMP
HVARIVQIGLRAQGSGRPEDLAAARAYGADLITAYELHDIGMDAVLARIPDGGNYYITID
ADGLDPSTMPAVAGPAPGGLTFAQTRKLIHGLVRKGRVVGMDIVEIQPKKDINQISCITA
GRLILNLIGTTIRAGYFD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctataccactgcgccccgcaccggtcaccagacgctgctgtatgcggagctg
gacaccgacctggacaacctgcaggccgacatcgccgtcctgggcatgccgttcggcacg
ccgtattccgcggccgatttcagcaacgaccagaccaatgcgcccgccgcgatccggcag
gccaccgaccgggtcgcgcgcgcgcccgggcactatgatttcgatatcgacggcccgctg
ctgcaaggccgcgacgacatccgcttcgtcgactgcggcgacatcgtccccgacctggcg
cagccgccgggcgaacactacgcccgcgccgaagcggcggtccggcgccttgcgaatgcc
ggcgcgctgcccatcgtcctgggcggcgaccatggcatcaccacgccgatcctgcgcggc
ctcgaccagaaggggccgatcacgctggtgcacatcgatgcgcacctggactggcgggat
tcggtcaacggcgtgaaggagggcctgtcgagccccatgcgccgcgcctcggagatgccg
cacgtcgcgcgcatcgtgcagatcggcctgcgcgcgcagggcagcggccgccccgaagac
ctggctgccgcgcgtgcctacggcgccgacctgatcaccgcctacgagctgcacgacatc
ggcatggacgcggtgctggcgcgcattccggacggcggcaactactacatcaccatcgac
gcggacgggctggacccttcgaccatgccggcggtcgcgggccccgcgcccggcggcctg
acgtttgcgcagacgcgcaagctgattcacggcctggtgcgcaagggccgcgtggtcggc
atggacatcgtcgaaatccagccgaagaaggacatcaaccagatctcgtgcatcacggcc
ggtcgcctgatcctgaacctgatcggcacgaccatccgcgcgggctatttcgactga

DBGET integrated database retrieval system