KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0274Help
Entry
RSP_0274          CDS       T00284                                 

Gene name
bchD
Definition
Magnesium-chelatase, subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSP_0274 (bchD)
Enzymes [BR:rsp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RSP_0274 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1998450..2000126
Genome map
AA seq 558 aa AA seqDB search
MPLGPWERVEAALTLLAIDPAGLKGLWLRARASALRDRITGALGALPLPVRRIHPTIGDD
ALFGGLDLAATLSAGTPVVQKGILDEPAVLVLAMAERTLPGLAARLGTALDAPRHCLIAL
DEGAERDELLPLGLVDRLALFLDLDGLPWGETREIALDPERLAAARARLAAVATPPEAAA
TLARVAAQLGIASLRAPTLALAAARAQAAWEGHAAVTDEDIRRAADLVFAHRAMPASEEA
PPEPEPEPPEDQPDDSPPPPEQQQGEEMFPEEMLVEAVRAALPADLLEQLAAGRAARMAR
GATGTGSAKAGNRRGRPLPSRMGRLGTGARIDLVGTLRAAAPWQPLRRRQQKTDAVLLVR
PSDIRIKRFRETSDRVLIFAVDASGSSAMARLSEAKGAVELLLGQAYARRDHVSLLAFRG
RDAELILPPTRSLVQTKRRLAGLPGGGGTPLAHGLRLALAVGLQARARGMTPTVALLTDG
RGNIALDGSANRAQAEEDALKLAASLRGSGLPAVVIDTANRPQPSLAALARALDAPYIAL
PRADAHKLSNVLGAAMGD
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctcggcccgtgggaacgggtcgaggcggccctcacccttctcgccatcgaccct
gcaggcctcaagggcctctggctccgggcgcgggccagcgcgctgcgcgaccggatcacc
ggggcgctcggcgcgctgccgctgccggtccgccgcattcatccgaccatcggcgacgat
gcgctcttcggcgggctggatctggccgcgaccctctcggccggcacgcccgtcgtgcag
aagggcatcctcgacgagcccgcggtgctggttctcgccatggccgagcgcaccctgccc
ggtctcgcggcccggctcggcaccgcgctcgatgcgccgcgccactgtctgatcgcgctc
gacgagggcgccgagcgcgacgagctgctgccgctcggcctcgtggaccggctggcgctg
ttcctcgacctcgacggcctgccctggggcgagacccgcgagatcgcgctcgaccccgag
cgcctcgccgcagcccgcgcccggctggccgcggtggcgaccccgcccgaggcggccgcg
accctcgcccgcgtggcggcgcagctcggcatcgcgagcctccgcgcgccgacgctggcg
ctggccgcggcccgcgcgcaggccgcctgggaaggtcacgccgccgtcacggacgaggac
atccgccgcgcggccgatctggtcttcgcccatcgcgccatgcctgcctccgaggaggcc
ccgcccgagcccgaacccgagccgcccgaggatcagcccgacgacagcccgccgccgccc
gagcagcagcagggcgaggagatgtttcccgaagagatgctggtcgaggccgtgcgggcg
gcgctgccggccgatctcctcgagcagctggccgccggtcgcgccgcgcggatggcgcgg
ggcgccaccggcaccggctcggccaaggccggcaaccgccgcggccgccccctgccctcg
cgcatgggccgcctcggcaccggcgcgcggatcgacctcgtgggcacgctgcgcgcggcc
gccccctggcagccgctccgccgccgccagcagaagaccgatgccgtgctgctcgtgcgg
ccctccgacatccgcatcaagcggttccgcgagacctcggaccgcgtgctgatcttcgcc
gtggatgcctcgggctcttccgccatggcgcgcctctccgaggcgaagggcgcggtcgag
cttcttctggggcaggcctatgcccggcgcgaccatgtctcgctgctggccttccggggc
cgcgacgccgagctgatcctgccgcccacccgcagcctcgtgcagacgaagcggcgcctt
gcgggcctgcccggcgggggcggcacgccgctcgcccacgggctgcggctggcgctggcc
gtggggcttcaggcccgcgcgcgcggcatgacacccacggtcgcgcttctgaccgacggg
cgcggcaacatcgcgctcgatggctcggccaaccgggcgcaggccgaggaggatgcgctg
aagctcgcggcctcgctgcgcggctcgggtctgcccgcggtcgtgatcgacacggcgaac
cgcccgcagccctcgctcgcggccctcgcccgcgccctcgacgcgccctacatcgccctg
ccgcgggccgatgcccacaagctctcgaacgtcctcggcgcagcaatgggagactga

DBGET integrated database retrieval system