KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0555Help
Entry
RSP_0555          CDS       T00284                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rsp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2292864..2293538)
Genome map
AA seq 224 aa AA seqDB search
MIGKVAGILDFRGPDHVLIDVRGVGYIVYVSDRTLASMPGLGEGVALYTELVVREDLLQL
FGFPTMIEKEWHRLLMTVQGVGAKAGMAILGALGAEGTARAITLGDARSIQAAPGIGPKI
AQRVVLELKSKAPALMAMGGGTAALAPSEPPEPEPGTSSGSRRKTRAPEPPRPSHTADAL
SALANLGYQPTDAAQAVAQAAGESPDADTAALIRAALKLLAPKS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaaggtggcggggatcctcgacttccgcggcccggatcatgtgctgatcgac
gtccgcggcgtgggctacatcgtctatgtctcggaccggacgctggcctcgatgccgggt
ctgggcgagggggtcgctctctataccgagctcgtggtgcgcgaggatctgctgcagctc
ttcggcttccccacgatgatcgagaaggaatggcatcggctgctgatgacggtgcagggc
gtgggggccaaggccggcatggcgatcctcggcgccctcggggcggaagggaccgcgcgg
gcgatcacgctcggcgatgcgcgctcgatccaggccgcgccagggatcgggcccaagatc
gcgcagcgggtggtgctggagctgaagagcaaggcgcctgcgctgatggcaatgggcggc
ggcacggcggcgctggcgccctccgagcccccggagcccgagcccggcacgtcgtccggc
agccgccgcaagacccgcgcgcccgagccgccgcggcccagccacacggccgacgcgctc
tcggccctcgccaatctcggctaccagccgaccgatgcggcgcaggccgtcgcgcaggcc
gcaggcgagagcccggacgccgatacggccgcgctgatccgggccgccctgaagctgctc
gcgccgaagtcataa

DBGET integrated database retrieval system