KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0579Help
Entry
RSP_0579          CDS       T00284                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSP_0579
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_0579
   00620 Pyruvate metabolism
    RSP_0579
   00640 Propanoate metabolism
    RSP_0579
  Energy metabolism
   00680 Methane metabolism
    RSP_0579
Enzymes [BR:rsp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RSP_0579
Lipid biosynthesis proteins [BR:rsp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RSP_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2319255..2321216)
Genome map
AA seq 653 aa AA seqDB search
MDHAQANAVYTASADFIAQAHVDAAGYERMYAASVADPEAFWGEQGKRLDWIKPYTKVKN
TNFRPGEVSIKWFEDGTLNIAWNCIDRHLATRAKQTAIIWEPDDPNVPAQHISYQELHDN
VCRMANVLVSQGVRKGDRVVMYLPMIPEAAYAMLACARIGAIHSVVFAGFSPDALANRIN
DCQAKVVITADTAPRGGRRTPLKSNTDAALLHCSDRVRCLVVKHTGDQIHWMDGRDVDVK
ELMRHASPDCPIEEVNAEDPLFILYTSGSTGKPKGVVHTSGGYLTYAAMTHQMTFDYHDG
DVFWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDAGRFWAVCEKHKVNQFYTAP
TAIRSLMGLGPEWVDKYDLSSLKLLGSVGEPINPEAWSWYNTHVGKGRCPIVDTFWQTET
GGHMITPLPGAIPVKPGAASKPFFGVKPVILDPTDGHELHETATEGVLCIADSWPGQMRT
LWGDHERFEEAYFSQYKGYYFTGDGCRRDADGYYWVTGRVDDVINVSGHRMGTAEVESAL
VAHAQVAEAAVVGYPHDIKGQGIYAYVTLMNGVQPTEELRKDLVKWVRTEIGPIASPDVI
QWAPGLPKTRSGKIMRRILRKIAENDFGSLGDTTTLADPSVVDDLIANRKNRG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgctcaggcgaatgcggtctataccgcgtcggcagatttcattgcgcaagcc
catgtcgacgcggccggctacgagcggatgtatgctgcatccgtggccgacccggaggcg
ttctggggcgaacagggcaagcggctcgactggatcaagccctacaccaaggtcaagaac
acgaacttccggccgggcgaggtctcgatcaagtggttcgaggacggcacgctgaacatc
gcctggaactgcatcgaccggcatctggcgacgcgggccaagcagaccgcgatcatctgg
gagccggacgatccgaacgtgccggcccagcacatcagctatcaggagctgcacgacaac
gtctgccgcatggccaacgtgctggtgagccagggcgtgcgcaagggcgaccgggtggtg
atgtatctgccgatgatccccgaggccgcctatgcgatgctggcgtgcgcccggatcggc
gccatccattccgtcgtcttcgcgggcttctcgcccgacgcgctggcgaaccggatcaac
gactgtcaggccaaggtggtcatcaccgccgacacggctccgcgtggcggccggcgcacg
cccttgaagtcgaacaccgacgcagcccttctccattgctcggaccgggtgcgctgcctc
gtcgtcaagcacacgggcgaccagatccactggatggacggccgcgacgtggacgtgaag
gagctgatgcgccacgcctcgcccgactgcccgatcgaggaggtgaatgccgaggatccg
ctcttcatcctctatacctcgggctcgaccggcaagccgaagggggtcgtgcacacctcg
ggcggctatctgacctatgccgccatgacccatcagatgaccttcgactaccatgacggc
gacgtcttctggtgcaccgcggacgtgggctgggtcacgggccacagctacatcgtctac
ggcccgctggcgaacggcgcgaccacgctcatgttcgagggcgtgccgacctatcccgat
gcgggccgcttctgggccgtctgcgagaagcacaaggtgaaccagttctacaccgcgccc
acggcgatccgctcgctgatgggcctcgggccggaatgggtcgacaagtacgacctgtcg
tcgctgaagctcttgggctcggtgggcgagccgatcaaccccgaggcctggagctggtac
aacacccatgtcggcaagggccgctgcccgatcgtcgacaccttctggcagaccgagacc
ggcggccacatgatcacgccgctgccgggcgcgatcccggtgaagccgggcgcggcctcg
aagcccttcttcggggtgaagccggtgatcctcgacccgaccgacgggcacgagctgcac
gaaaccgcgaccgagggggtgctctgcatcgccgacagctggccggggcagatgcgcacg
ctctggggcgaccacgagcggttcgaagaggcctatttctcgcaatacaagggctattac
ttcaccggcgacggctgccgccgcgatgcggacggctattactgggtcacgggccgggtc
gatgacgtcatcaacgtctcgggccaccggatgggcaccgccgaggtggaatccgcgctc
gtcgcccatgcgcaggtcgccgaagccgcggtggtgggctatccgcacgacatcaagggg
cagggcatctatgcctatgtcacgctgatgaacggggtccagccgaccgaggagctgcgc
aaggatctggtgaaatgggtccgcaccgagatcggccccatcgcctcgccggacgtgatc
cagtgggcgccgggcctgcccaagacccgctcgggcaagatcatgcgccgcatcctgcgc
aagatcgccgagaacgacttcggctcgctcggcgacaccacgacgctggccgatccgtcg
gtggtcgacgacctgatcgccaaccgcaagaaccggggctga

DBGET integrated database retrieval system