KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0632Help
Entry
RSP_0632          CDS       T00284                                 

Gene name
hisD1
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00340  Histidine metabolism
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    RSP_0632 (hisD1)
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RSP_0632 (hisD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 3718260
NCBI-ProteinID: YP_353706
UniProt: Q3J079
Position
1:complement(2367058..2368362)
Genome map
AA seq 434 aa AA seqDB search
MPQFLDTRRPGFEADFTALLGMKREDSPDVDAVVAGIIADVRARGDAAVIELTARFDRLE
LTPERLAFSEAEIEAEIATVSAEDRAALELAAERIRAYHARQMPENARWTDAAGAELGWR
WGPIASAGLYVPGGLASYPSSVLMNAIPARVAGVERLVVACPTPGGVVNPLVLLAARLAG
VDAVYRIGGAQAVAALAYGTETIRPVDKITGPGNAYVAAAKRRVFGRVGIDMIAGPSEIL
VIAEGAVDPDWIALDLLSQAEHDESAQSILVTPDEALGRAVVQAVEARLETLERRAIAGA
SWRDYGAVIVTRDLEEAAALSDRVAPEHLELCVADPEALAARIRHAGAIFLGGWTPEAIG
DYVGGPNHVLPTARSARFSSGLSVMDFLKRTTLARMTPAALRAVGPAAERLAISESLEAH
GLSVRARLDRLNEG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtttctcgacacccgtcggcccggcttcgaggcggatttcaccgcgcttctc
ggcatgaagcgcgaggacagccccgatgtcgatgcggtggtggccgggatcatcgcggat
gtgcgggcgcgcggggatgcggcggtgatcgagctgaccgcgcggttcgaccggctggag
ctgacgcccgaacggcttgccttctcggaggcggagatcgaggcggagatcgcgaccgta
tctgccgaggaccgcgcggcgctggagctcgcggccgagcggatccgggcctatcatgcc
cgccagatgccggagaatgcgcgctggaccgatgcggccggcgccgaactcggctggcgc
tgggggcccatcgcctcggccgggctctatgtgccgggggggctcgcctcctatccgtcc
tcggtgctgatgaatgcgatccccgccagggtcgcgggagtggagcggctggtcgtggcc
tgccccacgccgggcggcgtggtcaatccgctggtgctgctggccgcgcggctggcgggc
gtggatgccgtctaccggatcggcggggcgcaggcggtggcggcgctggcctacggcacc
gagacgatccggccggtcgacaagatcaccggcccgggcaatgcctatgtggcggcggcc
aagcggcgggtcttcggccgggtggggatcgacatgatcgcgggcccctccgagatcctc
gtgatcgcggaaggcgcggtcgatcccgactggatcgcgctcgaccttctgagtcaggcc
gagcatgacgagagcgcgcagtcgatcctcgtcacgcccgacgaggcgctcggacgggcc
gtcgtgcaggcggtcgaggcgcggctcgagacgctcgagcggcgggcgatcgcgggcgcc
tcgtggcgcgactacggggcggtgatcgtgacgcgcgatctggaggaggcggcggcgctg
tcggaccgggtggcgcccgagcatctcgaactgtgcgtggccgatcccgaggcgctggcc
gcgcggatccgccatgcgggggcgatctttctcggcggctggacgcccgaggcgatcggc
gactatgtgggcgggccgaaccatgtgctgcccaccgcccgctcggcgcgcttctcgagc
ggcctgtcggtgatggatttcctcaagcgcaccacgctcgcccggatgacgcccgcggcg
ctgcgcgccgtgggccccgccgccgagcggctggccatttcggagagcctcgaggcgcac
ggcctgtccgtccgcgcccggctcgaccggctgaacgagggctga

DBGET integrated database retrieval system