KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0705Help
Entry
RSP_0705          CDS       T00284                                 

Definition
Cytochrome cy
Orthology
K08738  
cytochrome c
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RSP_0705
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSP_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2450683..2451207)
Genome map
AA seq 174 aa AA seqDB search
MFDTMTLTKAVGAGCGALLVFLLGSWAASGLYTFGEGHGEDVTQAYVIDTGASAAAEEPA
AEAVPFPELVAAADAAAGQKVFAKCAACHKVDGSDATGPHLNGVVDRAVASVAGFAYSDA
MVAHAAEAPTWTLEELGAFVENPKGHVPGTKMTFAGLPKEQDRANVVAYLASLQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacgatgaccctgacgaaggcggtcggcgccgggtgcggcgcgctcctggtg
ttcctgcttggatcctgggcggccagcggcctttacaccttcggcgagggccacggcgag
gatgtgacgcaagcctatgtgatcgacacgggcgccagtgccgccgccgaggaaccggcc
gccgaagcggtgccgtttccggaactggtggctgcggccgatgcggcggcgggccagaag
gtcttcgccaaatgcgccgcctgtcacaaggtcgacggctcggacgcgacgggcccgcat
ctgaatggtgtggtcgaccgcgcggtggcctcggtggcgggcttcgcctattcggacgcg
atggtggcccatgccgccgaggcgccgacctggacgttggaagagctcggcgccttcgtc
gagaatcccaagggccatgtgccgggcaccaagatgaccttcgcgggcctgccgaaagag
caggaccgcgccaatgtcgtggcctatctggcctcgctccagtaa

DBGET integrated database retrieval system