KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0705Help
Entry
RSP_0705          CDS       T00284                                 

Definition
(RefSeq) Cytochrome cy
  KO
K08738  cytochrome c
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp01100  Metabolic pathways
rsp01120  Microbial metabolism in diverse environments
rsp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSP_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 3718183
NCBI-ProteinID: YP_353782
UniProt: Q3J003
Position
1:complement(2450683..2451207)
Genome map
AA seq 174 aa AA seqDB search
MFDTMTLTKAVGAGCGALLVFLLGSWAASGLYTFGEGHGEDVTQAYVIDTGASAAAEEPA
AEAVPFPELVAAADAAAGQKVFAKCAACHKVDGSDATGPHLNGVVDRAVASVAGFAYSDA
MVAHAAEAPTWTLEELGAFVENPKGHVPGTKMTFAGLPKEQDRANVVAYLASLQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacgatgaccctgacgaaggcggtcggcgccgggtgcggcgcgctcctggtg
ttcctgcttggatcctgggcggccagcggcctttacaccttcggcgagggccacggcgag
gatgtgacgcaagcctatgtgatcgacacgggcgccagtgccgccgccgaggaaccggcc
gccgaagcggtgccgtttccggaactggtggctgcggccgatgcggcggcgggccagaag
gtcttcgccaaatgcgccgcctgtcacaaggtcgacggctcggacgcgacgggcccgcat
ctgaatggtgtggtcgaccgcgcggtggcctcggtggcgggcttcgcctattcggacgcg
atggtggcccatgccgccgaggcgccgacctggacgttggaagagctcggcgccttcgtc
gagaatcccaagggccatgtgccgggcaccaagatgaccttcgcgggcctgccgaaagag
caggaccgcgccaatgtcgtggcctatctggcctcgctccagtaa

DBGET integrated database retrieval system