KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0712Help
Entry
RSP_0712          CDS       T00284                                 

Gene name
recR
Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RSP_0712 (recR)
DNA repair and recombination proteins [BR:rsp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RSP_0712 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2458234..2458833
Genome map
AA seq 199 aa AA seqDB search
MAEAPGDIERLIELMARLPGLGPRSARRAVLLMLKKRGAVMAPLAQAMAEVATSARDCVR
CGNITNADLCGICRDERRATGELCVVEDVADLWALERAGAFRGRYHVLGGVLSALDSVGP
EELRIPRLAERVREEGISEVILALNATVDGQTTAHYIADVLEPSGVQVTSLAQGVPIGGE
LDYLDDGTIGAALRARRRF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcccccggcgacatcgagcgtctgatcgagctgatggcgcggctgccgggg
ctcgggccccgctccgcccgccgggcggtgcttctgatgctgaagaagcggggggccgtc
atggcccctctggcacaggccatggccgaagtcgcgaccagcgcgcgcgattgtgtgcgc
tgcggcaacatcacgaacgccgatctctgcgggatctgccgcgacgagcgccgcgccacg
ggcgagctctgcgtggtggaggatgtggccgacctctgggcgctcgagcgcgcaggcgcc
ttccgcggccgctatcatgtgctgggcggcgttctctcggcgctggattcggtcggcccc
gaggagctgcgcatcccccgcctcgccgagcgggtgcgcgaggagggcatctccgaggtg
atcctcgcgctcaatgcaacggtggacggccagaccacggcccattacatcgccgacgtg
ctcgagccttcgggcgtgcaggtcacgtcgctggcccagggcgtgcccatcggcggcgag
ctcgactatctcgacgacggcaccatcggtgccgccctccgcgcccgccggcggttctga

DBGET integrated database retrieval system