KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0712Help
Entry
RSP_0712          CDS       T00284                                 

Gene name
recR
Definition
(RefSeq) DNA replication and repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RSP_0712 (recR)
DNA repair and recombination proteins [BR:rsp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RSP_0712 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2458234..2458833
Genome map
AA seq 199 aa AA seqDB search
MAEAPGDIERLIELMARLPGLGPRSARRAVLLMLKKRGAVMAPLAQAMAEVATSARDCVR
CGNITNADLCGICRDERRATGELCVVEDVADLWALERAGAFRGRYHVLGGVLSALDSVGP
EELRIPRLAERVREEGISEVILALNATVDGQTTAHYIADVLEPSGVQVTSLAQGVPIGGE
LDYLDDGTIGAALRARRRF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcccccggcgacatcgagcgtctgatcgagctgatggcgcggctgccgggg
ctcgggccccgctccgcccgccgggcggtgcttctgatgctgaagaagcggggggccgtc
atggcccctctggcacaggccatggccgaagtcgcgaccagcgcgcgcgattgtgtgcgc
tgcggcaacatcacgaacgccgatctctgcgggatctgccgcgacgagcgccgcgccacg
ggcgagctctgcgtggtggaggatgtggccgacctctgggcgctcgagcgcgcaggcgcc
ttccgcggccgctatcatgtgctgggcggcgttctctcggcgctggattcggtcggcccc
gaggagctgcgcatcccccgcctcgccgagcgggtgcgcgaggagggcatctccgaggtg
atcctcgcgctcaatgcaacggtggacggccagaccacggcccattacatcgccgacgtg
ctcgagccttcgggcgtgcaggtcacgtcgctggcccagggcgtgcccatcggcggcgag
ctcgactatctcgacgacggcaccatcggtgccgccctccgcgcccgccggcggttctga

DBGET integrated database retrieval system