KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0712Help
Entry
RSP_0712          CDS       T00284                                 

Gene name
recR
Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rsp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2458234..2458833
Genome map
AA seq 199 aa AA seqDB search
MAEAPGDIERLIELMARLPGLGPRSARRAVLLMLKKRGAVMAPLAQAMAEVATSARDCVR
CGNITNADLCGICRDERRATGELCVVEDVADLWALERAGAFRGRYHVLGGVLSALDSVGP
EELRIPRLAERVREEGISEVILALNATVDGQTTAHYIADVLEPSGVQVTSLAQGVPIGGE
LDYLDDGTIGAALRARRRF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcccccggcgacatcgagcgtctgatcgagctgatggcgcggctgccgggg
ctcgggccccgctccgcccgccgggcggtgcttctgatgctgaagaagcggggggccgtc
atggcccctctggcacaggccatggccgaagtcgcgaccagcgcgcgcgattgtgtgcgc
tgcggcaacatcacgaacgccgatctctgcgggatctgccgcgacgagcgccgcgccacg
ggcgagctctgcgtggtggaggatgtggccgacctctgggcgctcgagcgcgcaggcgcc
ttccgcggccgctatcatgtgctgggcggcgttctctcggcgctggattcggtcggcccc
gaggagctgcgcatcccccgcctcgccgagcgggtgcgcgaggagggcatctccgaggtg
atcctcgcgctcaatgcaacggtggacggccagaccacggcccattacatcgccgacgtg
ctcgagccttcgggcgtgcaggtcacgtcgctggcccagggcgtgcccatcggcggcgag
ctcgactatctcgacgacggcaccatcggtgccgccctccgcgcccgccggcggttctga

DBGET integrated database retrieval system