KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0831Help
Entry
RSP_0831          CDS       T00284                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSP_0831 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSP_0831 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSP_0831 (trpA)
Enzymes [BR:rsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSP_0831 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2576520..2577311)
Genome map
AA seq 263 aa AA seqDB search
MTRIDDTFRRLRAEGKKAFVAYIMAGDPDLETSLAVMRGLPEAGVDIIELGMPFTDPMAD
GPTIQTAGQRALEGGQTLTRTLEMVRAFRAENAETPIVMMGYYNPIYARGVETFLAEATE
AGIDGLIVVDLPPEEDAELCLPAQAAGLNFIRLATPTTDSRRLPKVLQNTSGFVYYVSIT
GITGAAAAQAADVAPEVARIKAATDLPVIVGFGITTPEAAQDLAGIADGCVVGSAIVKLV
GEGRPVAEVLDRVAALAAGAHAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgacgacaccttccggcggcttcgggccgaggggaagaaggccttcgtg
gcctatatcatggcgggcgatcccgatctcgagacgtcgcttgcggtgatgcggggcctg
ccggaggcgggcgtggacatcatcgagctgggcatgcccttcaccgatccgatggccgac
ggcccgacgatccagacggccggccagcgcgccctcgagggcggccagacgctgacccgg
acgctcgagatggtgcgcgccttccgggcggagaatgccgagacgcccatcgtgatgatg
ggttactacaatccgatctatgcgcgcggcgtcgagaccttcctcgccgaggcgacggag
gccgggatcgatgggctgatcgtggtggacctgccgcccgaggaggatgccgagctctgc
ctgcccgcacaggcggcggggctgaacttcatccggctcgcgacccccaccaccgacagc
cgccgcctgcccaaggtgctgcagaacacctcgggcttcgtctattacgtctcgatcacc
ggcatcaccggcgcggcggccgcgcaggcggccgatgtggcgcccgaagtggcgcgcatc
aaggccgcgacggatctgccggtcatcgtgggcttcggcatcaccacccccgaggccgcg
caggacctcgcgggtatcgccgacggctgcgtggtgggctcggcgatcgtgaagctcgtg
ggcgagggccggccggtggccgaggtgctggaccgggtggcggcgctcgcggccggcgct
cacgcggcctga

DBGET integrated database retrieval system