KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0964Help
Entry
RSP_0964          CDS       T00284                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSP_0964 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSP_0964 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RSP_0964 (sucB)
Enzymes [BR:rsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RSP_0964 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2723222..2724751)
Genome map
AA seq 509 aa AA seqDB search
MGTEVRVPTLGESVSEATVATWFKKPGDRVAADEMLCELETDKVTVEVHAPVAGRLVEIV
APEGTTVAVSALLAQIGAAEAGEDPAPEKTHAGAEAKAGAGESKMIDVMVPALGESVSEA
TVSTWFKKPGDTVAQDEMLCELETDKVSVEVPAPAAGVLAEILVTEGTTVAAGSKLALIS
SDGQGVAAAPKAETPKKTEAAPAQEPAPKKDVEDAPSARKAMAEAGLSPDAVQGTGRDGR
IMKDDVARAVSGASQAAAPTPAPQPALPRQPVPADDAAREERVKMTRLRQTIARRLKEAQ
NTAAMLTTYNEVDMSGVMGLRNEYKDAFEKKHGTKMGFMSFFVKACCHALKEVPEVNAEI
DGTDIVYKNYVHMGVAVGTPSGLVVPVVRDADQMGFAQIEKKIAELGLRARDGKLSMAEM
QGGSFTISNGGVYGSLMSSPILNPPQSGILGMHKIQERPVVEKGQIVIRPMMYLALSYDH
RIVDGKGAVTFLVRVKEALEDPRRLLLDL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggaacggaagtaagggttccgacgctgggagagagcgtctccgaggcgacggtcgcc
acctggttcaagaagccgggcgaccgggtcgcggccgacgagatgctctgcgagctcgag
accgacaaggtgaccgtcgaggttcacgcgccggtcgcgggccggctggtcgagatcgtc
gcccccgaggggacgacggttgcggtctcggcgcttctggcgcagatcggagcagcggag
gccggcgaagacccggctccggagaagactcatgcgggcgccgaggcgaaggccggcgcg
ggagagagcaagatgatcgacgtgatggtgcctgcccttggggaatcggtgtccgaggcg
accgtgtccacctggttcaagaagccgggcgataccgtggcgcaggacgagatgctctgc
gagctcgagaccgacaaggtctcggtcgaggtgccggcgcccgccgcgggcgtgctggcc
gagatcctcgtgaccgagggcacgacggtcgccgcgggctcgaagctcgcgctgatctcg
tccgacgggcagggcgtggccgccgcgccgaaggccgagacgccgaagaagaccgaggcc
gcccccgcgcaggagcccgcgccgaagaaggatgtcgaggatgcaccctcggccaggaag
gcgatggccgaggccggcctctcgcccgacgcggtgcagggcaccgggcgcgatggccgc
atcatgaaggacgacgtagcccgcgccgtctcgggcgcctcgcaggccgcggcccccacg
cccgccccgcagcccgcgctgccgcgccagccggtcccggccgacgatgcggcgcgtgag
gagcgggtcaagatgacccgtctgcgccagaccatcgcccgccgcctgaaggaggcgcag
aacaccgccgccatgctcaccacctacaacgaggtggacatgtcgggcgtcatgggcctg
cgcaacgaatacaaggacgcgttcgagaagaagcacggcaccaagatgggcttcatgtcc
ttcttcgtgaaagcctgctgccatgcgctgaaggaagtgcccgaggtcaatgccgagatc
gacggcaccgacatcgtctacaagaactacgtccacatgggcgtggcggtgggcaccccc
tcgggcctcgtggtgccggtggtgcgcgacgccgaccagatgggcttcgcccagatcgag
aagaagatcgccgaactcgggctgcgtgcccgtgacggcaagctctcgatggccgagatg
cagggcggcagcttcaccatctcgaacggcggcgtctatggctcgctcatgtcctcgccg
atcctgaacccgccgcagtcgggcatcctcggcatgcacaagatccaggagcggccggtg
gtcgagaagggccagatcgtcatccgcccgatgatgtatctcgcgctcagctacgatcac
cgcatcgtcgatggcaagggcgcggtgaccttcctcgtccgcgtcaaggaggcgctcgag
gatccgcgccgcctgctgctcgacctctga

DBGET integrated database retrieval system