KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0967Help
Entry
RSP_0967          CDS       T00284                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00020  Citrate cycle (TCA cycle)
rsp00640  Propanoate metabolism
rsp00660  C5-Branched dibasic acid metabolism
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01120  Microbial metabolism in diverse environments
rsp01130  Biosynthesis of antibiotics
rsp01200  Carbon metabolism
Module
rsp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSP_0967 (sucC)
   00640 Propanoate metabolism
    RSP_0967 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RSP_0967 (sucC)
Enzymes [BR:rsp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RSP_0967 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 3720758
NCBI-ProteinID: YP_354051
UniProt: Q3IZ84
Position
1:complement(2728661..2729854)
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLRSYGAPVSDGRVVLKADEAKSAAGELGGPLWVVKAQIHAGGRGKGKFK
EPEAGEKGGVRLAKSVGEAAELAKQMLGRTLVTHQTGPAGKQVNRIYIEEGSDIARELYL
ALLVDRGTSRISFVVSTEGGMDIEEVAASTPEKIVSFSVDPASGLSDFHGRRVAFALGLE
GAQVKQCVQLVKNLYRAFVEKDMEMLEINPLIVMTDGNLKVLDAKVGFDNNALYRQSDVM
ALRDETEEDPKELAASKFDLNYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTEAFKIITSDPNVKGILVNIFGGIMRCDIIAEGIIAAVKEVGLQVPLVVRLE
GTNVEKGKEIIANSGLNVIAGDNLSDAAQKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaggcgaaggcgctcctgcgcagctacggtgcgccggtgtcc
gacggccgggtcgtgctgaaggccgacgaagccaaatccgcggcaggcgagctcggcggg
ccgctctgggtcgtcaaggcgcagatccatgcgggcggacgcggcaagggcaaattcaag
gagccggaagcgggcgagaagggcggcgtgcgtctggccaagtccgtgggcgaagcggcc
gagcttgccaagcagatgctgggccgcacgctcgtcacccaccagaccggcccggccggc
aagcaggtgaaccgcatctacatcgaggaaggctcggacattgcgcgcgagctctacctc
gcgctgctggtggaccgcggcacctcgcgcatctccttcgtcgtctcgaccgaaggcggg
atggacatcgaggaagtggcggcctcgacgcccgagaagatcgtctccttctcggtcgat
ccggcctcgggcctgtcggacttccacggccgccgcgtcgccttcgccctcgggctcgaa
ggcgcgcaggtcaagcaatgcgtgcagctggtcaagaacctctaccgcgccttcgtcgag
aaggacatggagatgctcgagatcaacccgctgatcgtcatgaccgacggcaacctcaag
gtgctcgacgccaaggtgggcttcgacaacaacgcgctctaccgccagtccgacgtcatg
gcgctgcgcgacgagaccgaagaggatccgaaggaactcgcggcctcgaagttcgacctg
aactacatcgcgctcgacggcgagatcggctgcatggtgaacggcgcgggcctcgccatg
gccacgatggacatcatcaagctctacggcgcggagcctgcgaacttcctcgacgtgggc
ggcggcgccacgaaggagaaggtgaccgaggccttcaagatcatcacctcggacccgaac
gtgaagggcatcctcgtcaacatcttcggcggcatcatgcgctgcgacatcatcgcggaa
ggcatcatcgccgcggtgaaggaagtggggctgcaggttccgctggtcgtgcgcctcgag
ggcacgaacgtcgagaagggcaaggagatcatcgcgaattccggcctcaacgtcatcgcg
ggcgacaatctgtcggacgcggcacagaagatcgtcaaagcggtgaagggataa

DBGET integrated database retrieval system