KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1128Help
Entry
RSP_1128          CDS       T00284                                 

Gene name
dapE
Definition
succinyldiaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSP_1128 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    RSP_1128 (dapE)
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RSP_1128 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2891996..2893138)
Genome map
AA seq 380 aa AA seqDB search
MPIDPVALTADLVRCPSVTPEEGGALDLIERILSGAGFDCTRVDRNGVPNLFARWGRKGA
NRTFGFNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAVDFVQE
TPPDGAVVLTITGDEEGDSTDGTVALLDWMAAEGEAMSVCLVGEPTCPERLGEMMKIGRR
GSMTAFFTARGVQGHSAYPHRAKNPVAALARLIDRLSSHDLDYGTEHFDASTLAVTTFDT
GNPATNVIPALCRATVNIRFNDAHSGASLTRWLEEEAARVAADTGVEIALSAKISGESFL
TPPGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMHQVDERVE
VAQIEPLKAIYLRILKDYFA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgatcccgtcgcgctgaccgccgatctcgtccgctgcccctcggtcacgccc
gaggagggcggcgcgctcgacctgatcgagcggatcctgagcggggcgggcttcgactgc
acccgcgtggaccgcaacggggtgccgaacctcttcgcccgctggggccggaagggcgcg
aaccggaccttcggcttcaacggccataccgatgtggtgccggtgggcgatgccgccgcc
tggacccgcgatccgttcggcggcgagatcgccgacggctggctctgggggcgcggggcc
accgacatgaagtcgggcgtcgcggccttcgtggcagcggcggtcgatttcgtgcaggag
accccgcccgacggggcggtggtcctgaccatcaccggtgacgaggagggcgactcgacc
gacggcacggtcgcgcttctcgactggatggcggcggagggcgaggccatgtcggtctgc
ctcgtcggagagcccacctgccccgagcggctgggcgagatgatgaagatcggccgccgc
ggttcgatgacggcctttttcaccgcccgcggcgtgcagggccattcggcctatccgcat
cgggcgaagaacccggtcgccgcgctggcgcggctgatcgatcggctgtcctcgcacgat
ctcgactatggcaccgagcatttcgatgcctcgacgctggccgtgaccaccttcgacacc
ggcaacccggccaccaacgtgatcccggctctctgccgcgcgacggtgaacatccgtttc
aacgatgcccacagcggtgcgagcctgacccgctggctggaggaggaggccgcccgcgtc
gcggctgacaccggcgtcgagattgcgctcagcgccaagatctcgggcgagagcttcctc
acgccgccgggcgagctttccgaactggtggcccgcgcggtcgaggccgagaccggcctg
cggcccgagccctcgacctcgggcggcacctcggacgcgcgcttcgtgcgcgcccactgc
ccggtggtggaattcggccttgtcggcaagaccatgcatcaggtggacgagcgtgtcgaa
gtcgcgcagatcgaaccgctgaaggccatctacctccgcattctgaaagactatttcgca
tga

DBGET integrated database retrieval system