KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1159Help
Entry
RSP_1159          CDS       T00284                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RSP_1159 (galU)
   00052 Galactose metabolism
    RSP_1159 (galU)
   00500 Starch and sucrose metabolism
    RSP_1159 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    RSP_1159 (galU)
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RSP_1159 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2921282..2922175)
Genome map
AA seq 297 aa AA seqDB search
MTTNKVTKAVFPVAGLGTRFLPATKSIPKEIMTLVDRPLIQYAIDEARAAGIKEFIFVTS
RGKSALEDYFDNAPELEAALKKPGKEHLLDVLESTNMESGAIAYVRQHKALGLGHAVWCA
RRLIGDEPFAVMLPDDVIAAEKPCLQQMVEAYEQTGGNMVAAMEVPPEKASAYGVLSVAE
DMGSIVKVNGMVEKPKENPPSNLAVIGRYILTPQVLNNLNRKKEGAGGEIQLTDAIAEEI
DESGKVYGFRFRGQRYDCGSKAGFLQATVAFGLARPELRDEFSGYLHDMLALEKAAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaacaaggttaccaaggccgtatttcccgtcgcaggactgggcacgcgcttt
ctgccggcgaccaagtcgatcccgaaagagatcatgacgctggtcgaccgccccctgatc
caatatgcgatcgatgaggctcgggcggccggcatcaaggaattcattttcgtcacctcg
cgcggcaagagcgcgctcgaggattatttcgacaatgcgcccgaactcgaagccgcgctg
aagaagcccggcaaggagcatctgctcgacgtgctggaaagcaccaacatggaaagcggc
gccatcgcctatgtccgccagcacaaggcgctgggccttggccatgcggtctggtgcgcg
cgccgcctgatcggcgacgagcccttcgcggtgatgctgccggatgacgtgatcgcggcc
gagaagccctgcctgcagcagatggtggaggcctacgaacagaccggcggcaacatggtg
gccgcgatggaagtgccgcccgagaaagcttcggcctatggcgtgctctcggtcgccgag
gacatgggctcgatcgtcaaggtcaatggcatggtcgagaaaccgaaggaaaatccgccg
tccaatcttgccgtgatcgggcgctacatcctgacgccgcaggttctgaacaacctgaac
cgcaagaaggaaggcgccgggggggagatccagctgaccgatgcgatcgccgaagagatc
gacgagtccggcaaggtctacggcttccgcttccgcggccagcgctacgactgcggctcg
aaggcaggcttcctgcaggcgaccgtggccttcggcctcgcgcgccccgagctgcgggac
gagttctcgggctacctgcacgacatgctggctctggagaaggcggcgcaataa

DBGET integrated database retrieval system