KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1176Help
Entry
RSP_1176          CDS       T00284                                 

Gene name
xylA
Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rsp00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rsp00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2943605..2944906)
Genome map
AA seq 433 aa AA seqDB search
MTDFFAGIPQIRYEGEGSSNEFAFRHYNPDEVILGKRMEDHLRFAVAWWHSFAWPGGDPF
GGQTFDRPWFGDTLDLAKLKADVAFEMFDILGAPFFCFHDADIRPEGATFAESKRNLEEI
VDHIGIRMEGSKTKLLWGTANLFSHRRFMSGAATNPDPDVFAWSAATVKGCMDATMKLGG
ANYVLWGGREGYETLLNTDLTREAENAGRFLQMVVDYKHKIGFQGTILIEPKPQEPSKHQ
YDYDVATVYGFLKRFGLEKEVKLNIEQGHAILAGHSFEHELALAASLGILGSIDMNRNDY
QSGWDTDQFPHNHPEMALAYYEILRAGGFTTGGTNFDAKIRRQSLDPEDLVLAHVGGMDT
CARALKAAARLYEDGSLETARAARYAGWETPEAQAMLASSLEKIEARVLAEGINPEPRSG
RQERLENLWNRFV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcttcgcgggtatcccgcagatccgctacgagggcgaaggctcctccaac
gaattcgccttccgccactacaatcccgacgaggtgatcctcggcaagcggatggaagac
catctgcgcttcgcggtcgcctggtggcacagcttcgcctggccgggcggcgatccgttc
ggcggccagaccttcgaccggccgtggttcggcgatacgctggacctcgcaaagctcaag
gccgacgtggccttcgagatgttcgacatcctcggcgcgcccttcttctgcttccacgat
gccgacatccgcccggaaggcgcgaccttcgccgaaagcaagcgcaacctcgaggagatc
gtcgaccatatcggcatcaggatggaagggtcgaagacgaagctcctctggggcacggcg
aacctcttctcgcaccgccgcttcatgtcgggcgcggccaccaaccccgaccccgacgtc
ttcgcctggtcggcggccacggtgaagggctgcatggacgcgacgatgaagctcggcggc
gcgaactatgtgctctggggcgggcgcgagggctacgagacgctgctcaacaccgacctc
acccgcgaggccgagaatgcgggccgcttccttcagatggtggtggattacaagcacaag
atcggtttccagggcacgatcctgatcgagccgaagccgcaggagccctcgaagcaccag
tacgactatgacgtggcgacggtctacggcttcctcaagcgtttcggcctcgagaaggag
gtgaagctcaacatcgagcagggccacgcgatcctcgccggccacagtttcgagcacgag
ctggcgctggcggcgagcctcggcatcctcggctcgatcgacatgaaccggaacgactat
cagtcgggctgggataccgatcagttcccgcacaaccaccccgagatggccttggcctat
tacgagatcctgcgggcgggcggcttcaccacgggcggcacgaacttcgacgcgaagatc
cgccgccagagcctcgatcccgaggatctcgtgctggcccatgtgggtggcatggacacc
tgcgcccgtgcgctgaaggccgcggcgcggctctatgaggacggaagcctcgagaccgcg
cgcgccgcgcgctatgcgggctgggagacgcccgaggcgcaggcgatgctcgcctcttcg
ctggagaagatcgaggcccgcgtgctggccgaggggatcaaccccgagccgcgctcgggc
cggcaggagcggctggaaaacctctggaaccgcttcgtctga

DBGET integrated database retrieval system