KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1339Help
Entry
RSP_1339          CDS       T00284                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    RSP_1339
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     RSP_1339
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     RSP_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3108074..3108925
Genome map
AA seq 283 aa AA seqDB search
MPELPEVETVRRGLEPAMAGRLIAEARVNRADLRWPFPPRMAERLTGQRVLRLRRRSKYI
LADLSGGQSLLIHLGMSGRMLVSGAQLGEFFHDHPAPSRHDHVVLEMEGGARITFNDARR
FGAMDLVATEAAEAHPLLAVLGPEPLGNAFDGAYLAARLEGRRTPIKAALLDQRIVAGLG
NIYVCEVLFRAGLAPGRLAGSLSRAEAEGLVPLIREVLLEAIEAGGSSLRDYRQADGELG
YFQHTFRVYGREGLPCVTPGCSGTVGRIVQSGRSSFHCPLCQR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcttccagaagtcgaaaccgtgcgccgggggctcgagcccgcgatggcgggc
aggctgatcgccgaggcgcgggtgaaccgcgcggatctgcgctggccctttcccccgcgc
atggccgagcggctgacgggccagcgggttctgcggctgcggcggcggtcgaagtacatt
ctcgcggacctctcgggggggcagtcgctgctgatccatctcggcatgtcggggcggatg
ctggtctcgggcgcgcagctgggagagttcttccacgaccatcccgcgccctcgcgtcac
gatcatgtggtgctcgagatggagggaggcgcgcgcatcaccttcaacgatgcgcgccgc
ttcggggcgatggatctggtggcgacggaggcggccgaggcccatccgctgctcgccgtg
ctgggccccgagccgctcggcaacgccttcgacggcgcctatctcgcggcccggctcgaa
gggcggcggacgccgatcaaggcggcgctcctcgaccagcggatcgtggcgggcctcggc
aacatctatgtctgcgaggtgctgttccgcgcaggcctggcgcccggccgcctggcgggc
agcctgagccgcgccgaggccgagggcctcgtgccgctgatccgcgaggtgctccttgag
gcgatcgaggcgggcggatcctcgttgcgcgattaccgtcaggcggatggcgagctcggc
tacttccagcacacgttcagggtgtacggacgcgagggtttaccctgcgtgacgcccggt
tgctccggcaccgtggggcggatcgtgcagtcgggacgctcgtccttccactgcccgctc
tgccagagatga

DBGET integrated database retrieval system