KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1368Help
Entry
RSP_1368          CDS       T00284                                 

Gene name
pncA
Definition
putative pyrazinamidase/nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RSP_1368 (pncA)
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     RSP_1368 (pncA)
    3.5.1.-  
     RSP_1368 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3146010..3146615)
Genome map
AA seq 201 aa AA seqDB search
MRPQTEALIVIDVQNDFCPGGALAVAGGDAIIPRINALLPEFGARIFTQDWHPADHSSFA
STHEAVPFSLIEMPYGPQVLWPTHCVQGTRGAEFHPALETAPADLVLRKGFRRDIDSYSA
FFENDRTTPTGLEGYLRSRGIEAVTLAGLATDFCVAYSALDAARLGFRVTVLEGASAAID
LNGSLAAIKAQMAEAGVALEP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccccagaccgaagccctgatcgtcatcgacgtgcagaacgacttctgcccgggc
ggcgcgctcgccgtcgccggaggggacgcgatcatcccccggatcaacgcgctcctgccc
gagttcggcgcgcgcatcttcacgcaggactggcatccggcagaccattcctccttcgct
tccacccacgaggcggtgcctttctctctgatcgagatgccctacgggccgcaggtgctc
tggcccacccattgcgtgcagggcacgcgcggcgccgagttccatcccgcgctcgagacg
gcgccggccgatctcgtcctccgcaagggcttccgtcgcgacatcgacagctactcggcc
ttcttcgagaacgaccgcaccacccccaccggcctcgagggctacctgcgcagccgcggg
atcgaggcggtgacgctcgcgggcctcgccaccgacttctgcgtggcctattccgcgctc
gatgcggcccggctgggcttccgggtgacggtgctggaaggcgcctcggccgccatcgac
ctcaacggatcgctcgccgcgatcaaggcgcagatggccgaggccggcgtcgcgctggag
ccctga

DBGET integrated database retrieval system