KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1513Help
Entry
RSP_1513          CDS       T00284                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsp01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rsp00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rsp00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:99594..100799
Genome map
AA seq 401 aa AA seqDB search
MSAYLKSHPTHDGFFGPYGGAMLPPPLEPHFAAIREAYGRISKSADFIAELRYIRKHFQG
RPTPVSHLKNLSALCGGAQIYAKREDLNHTGAHKLNHCMAEGLLARFMGKTKLMAETGAG
QHGVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLLGATVVPVGFGGRSLKEAVDSC
FQSYLAQADTALFAIGSVVGPHPFPMMVRDFQHVVGVEAREQFLEMTGELPDMVAACVGG
GSNAMGIFSGFLDDEVALYGIEPCGTSSKLGDHAATIAYGEDGDIHGFRTMVLKDAEGNP
APVHTVASGLDYPGVGPEHAFLHRSGRVTYTGADDREALAAFFALSRHEGIIPALESAHA
VAFAMREAKAHPGKSILVNLSGRGDKDIDYVTQTFGFGETA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctatctgaaatcccacccgacccacgacggcttcttcggcccctacggaggc
gccatgctgccgcctccgctcgagccccatttcgccgccatccgcgaggcctatggccgg
atctcgaaatcggccgatttcatcgccgagctgcgctacattcgcaagcatttccagggc
cggcccacgccggtctcccacctgaagaacctctcggcgctctgcggcggcgcccagatc
tatgccaagcgcgaggatctgaaccacaccggcgcgcacaagctgaaccactgcatggcc
gaggggctgctcgcccgcttcatgggcaagaccaagctgatggccgagaccggcgcgggc
cagcacggcgtggcgctggccacggccgcggcctatttcggcatggaatgcgagatccac
atgggcgagatcgacatcgccaaggaggcgccgaacgtcacgcgcatgaagctgctgggc
gccacggtggtgccggtgggcttcggcggccgctcgctgaaggaagcggtcgacagctgc
ttccagagctacctcgcccaggccgatacggcgctcttcgccatcggctcggtcgtgggg
ccgcatccgttcccgatgatggtgcgcgacttccagcatgtggtgggggtcgaggcgcgc
gagcagttcctcgaaatgacgggcgagctgcccgacatggtggcagcctgcgtgggcggc
ggatcgaatgcgatggggatcttctcgggcttcctcgacgacgaggtggcgctctacggg
atcgagccctgcggcacctcctcgaagctcggcgaccatgcggcgacgatcgcttacggc
gaagacggcgacatccacggcttccgcaccatggtgctgaaggatgccgagggcaatccg
gcgccggtccataccgtggcctccggcctcgactacccgggcgtcggccccgaacatgcc
ttcctgcaccgttccgggcgcgtgacctataccggcgccgacgaccgcgaggcgctcgcg
gccttcttcgccctctcgcgccacgagggcatcatccccgccctcgaaagcgcccatgcc
gtggccttcgccatgcgcgaggcgaaggcccatccgggcaagtcgatcctcgtcaacctc
tcggggcgcggcgacaaggacatcgactacgtcacccagaccttcggcttcggcgagacc
gcctga

DBGET integrated database retrieval system