KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1513Help
Entry
RSP_1513          CDS       T00284                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSP_1513 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSP_1513 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSP_1513 (trpB)
Enzymes [BR:rsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSP_1513 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:99594..100799
Genome map
AA seq 401 aa AA seqDB search
MSAYLKSHPTHDGFFGPYGGAMLPPPLEPHFAAIREAYGRISKSADFIAELRYIRKHFQG
RPTPVSHLKNLSALCGGAQIYAKREDLNHTGAHKLNHCMAEGLLARFMGKTKLMAETGAG
QHGVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLLGATVVPVGFGGRSLKEAVDSC
FQSYLAQADTALFAIGSVVGPHPFPMMVRDFQHVVGVEAREQFLEMTGELPDMVAACVGG
GSNAMGIFSGFLDDEVALYGIEPCGTSSKLGDHAATIAYGEDGDIHGFRTMVLKDAEGNP
APVHTVASGLDYPGVGPEHAFLHRSGRVTYTGADDREALAAFFALSRHEGIIPALESAHA
VAFAMREAKAHPGKSILVNLSGRGDKDIDYVTQTFGFGETA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctatctgaaatcccacccgacccacgacggcttcttcggcccctacggaggc
gccatgctgccgcctccgctcgagccccatttcgccgccatccgcgaggcctatggccgg
atctcgaaatcggccgatttcatcgccgagctgcgctacattcgcaagcatttccagggc
cggcccacgccggtctcccacctgaagaacctctcggcgctctgcggcggcgcccagatc
tatgccaagcgcgaggatctgaaccacaccggcgcgcacaagctgaaccactgcatggcc
gaggggctgctcgcccgcttcatgggcaagaccaagctgatggccgagaccggcgcgggc
cagcacggcgtggcgctggccacggccgcggcctatttcggcatggaatgcgagatccac
atgggcgagatcgacatcgccaaggaggcgccgaacgtcacgcgcatgaagctgctgggc
gccacggtggtgccggtgggcttcggcggccgctcgctgaaggaagcggtcgacagctgc
ttccagagctacctcgcccaggccgatacggcgctcttcgccatcggctcggtcgtgggg
ccgcatccgttcccgatgatggtgcgcgacttccagcatgtggtgggggtcgaggcgcgc
gagcagttcctcgaaatgacgggcgagctgcccgacatggtggcagcctgcgtgggcggc
ggatcgaatgcgatggggatcttctcgggcttcctcgacgacgaggtggcgctctacggg
atcgagccctgcggcacctcctcgaagctcggcgaccatgcggcgacgatcgcttacggc
gaagacggcgacatccacggcttccgcaccatggtgctgaaggatgccgagggcaatccg
gcgccggtccataccgtggcctccggcctcgactacccgggcgtcggccccgaacatgcc
ttcctgcaccgttccgggcgcgtgacctataccggcgccgacgaccgcgaggcgctcgcg
gccttcttcgccctctcgcgccacgagggcatcatccccgccctcgaaagcgcccatgcc
gtggccttcgccatgcgcgaggcgaaggcccatccgggcaagtcgatcctcgtcaacctc
tcggggcgcggcgacaaggacatcgactacgtcacccagaccttcggcttcggcgagacc
gcctga

DBGET integrated database retrieval system