KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1588Help
Entry
RSP_1588          CDS       T00284                                 

Gene name
cheB1
Definition
chemotaxis methylesterase, CheB1 (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSP_1588 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RSP_1588 (cheB1)
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RSP_1588 (cheB1)
Two-component system [BR:rsp02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RSP_1588 (cheB1)
Bacterial motility proteins [BR:rsp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RSP_1588 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:178668..179777
Genome map
AA seq 369 aa AA seqDB search
MTTHAAAPSTRVLIVDDSAAARAMFKVIVESDPALQVMAAVPDAFAAARAMRTELPDVIL
LDLELPGMDGLTFLRKIMQQHPIPVVVCSSHVGAGTEAMVSALELGAREVISKPAARNDL
ERQEASIRICDAIRAATETTRRRSQPEPRPLAPGPKLTADEILPARPPRPVPETMPVVCI
GASTGGTEALRDVLTALPASAPPIVIVQHMPRGFTAAFARRLDSLCAIEVLEAEDEMQVM
PGRAIIAQGDRHLLLRRRNQGYRVSVLDGAYVCRHRPSVDVLFRSAAQEAGGNALGVIMT
GMGDDGARCMAEMRAAGAETIAQNEESCVVYGMPREAVAHGGVGKVEPLDRLAARIMEFG
RRHTERTVR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacacgcggcagccccctctacccgcgtcctcatcgtcgacgattccgcggcc
gcgcgcgccatgttcaaggtgatcgtcgagagtgatccggcgctccaggtcatggccgcc
gtccccgacgcctttgcagctgcgcgcgccatgcgaacggaactgcctgacgtgatcctg
ctcgatcttgagcttccaggcatggacggcctgaccttcctgcgcaagatcatgcagcag
catccgatcccggtggtcgtctgctcgagccatgtcggagccggcaccgaggcgatggtc
tcggccctggaactgggggcgcgcgaggtcatttccaagcccgccgcccgcaacgacctc
gaacggcaggaagcctcgatccggatctgcgacgcgatccgcgccgcaaccgagacgacg
cgccgccgtagccagcccgagccgcgtcccctggcgcctgggcccaaactcaccgccgac
gagatcctgcccgcgcgtccgccgcgcccggtgccagaaacgatgcccgtcgtctgcatc
ggcgcctcgaccggcggcaccgaagccctgcgggacgttctcacggcactgcccgcctcc
gcgccgccgatcgtgatcgtccagcacatgccgcgcggcttcacggccgccttcgcgcgc
cggctcgactcgctctgcgccatcgaggtactggaggcggaggatgagatgcaggtcatg
cccggccgcgccatcatcgcgcagggcgaccgccacctgctgcttcggcgccgcaatcag
ggctaccgcgtgtcggtgctggatggcgcctacgtctgccgccaccgaccctctgtcgat
gtgctcttccgctcggcggcgcaggaagcgggcgggaacgcgctcggtgtcatcatgacg
ggcatgggtgacgacggagcgcgctgcatggccgagatgcgtgcggccggcgcggaaacc
attgcccagaacgaagaaagctgcgtcgtctacggaatgccgcgcgaggcggtggcccat
ggcggggtcgggaaggtagagcctctggacaggctcgcggcccggatcatggaattcggc
cggcgccacacggaaaggaccgtccgatga

DBGET integrated database retrieval system