KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1588Help
Entry
RSP_1588          CDS       T00284                                 

Gene name
cheB1
Definition
(RefSeq) chemotaxis methylesterase, CheB1
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02020  Two-component system
rsp02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSP_1588 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RSP_1588 (cheB1)
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RSP_1588 (cheB1)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     RSP_1588 (cheB1)
Two-component system [BR:rsp02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RSP_1588 (cheB1)
Bacterial motility proteins [BR:rsp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RSP_1588 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-GeneID: 3718577
NCBI-ProteinID: YP_351632
UniProt: Q3J653
Position
1:178668..179777
Genome map
AA seq 369 aa AA seqDB search
MTTHAAAPSTRVLIVDDSAAARAMFKVIVESDPALQVMAAVPDAFAAARAMRTELPDVIL
LDLELPGMDGLTFLRKIMQQHPIPVVVCSSHVGAGTEAMVSALELGAREVISKPAARNDL
ERQEASIRICDAIRAATETTRRRSQPEPRPLAPGPKLTADEILPARPPRPVPETMPVVCI
GASTGGTEALRDVLTALPASAPPIVIVQHMPRGFTAAFARRLDSLCAIEVLEAEDEMQVM
PGRAIIAQGDRHLLLRRRNQGYRVSVLDGAYVCRHRPSVDVLFRSAAQEAGGNALGVIMT
GMGDDGARCMAEMRAAGAETIAQNEESCVVYGMPREAVAHGGVGKVEPLDRLAARIMEFG
RRHTERTVR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacacgcggcagccccctctacccgcgtcctcatcgtcgacgattccgcggcc
gcgcgcgccatgttcaaggtgatcgtcgagagtgatccggcgctccaggtcatggccgcc
gtccccgacgcctttgcagctgcgcgcgccatgcgaacggaactgcctgacgtgatcctg
ctcgatcttgagcttccaggcatggacggcctgaccttcctgcgcaagatcatgcagcag
catccgatcccggtggtcgtctgctcgagccatgtcggagccggcaccgaggcgatggtc
tcggccctggaactgggggcgcgcgaggtcatttccaagcccgccgcccgcaacgacctc
gaacggcaggaagcctcgatccggatctgcgacgcgatccgcgccgcaaccgagacgacg
cgccgccgtagccagcccgagccgcgtcccctggcgcctgggcccaaactcaccgccgac
gagatcctgcccgcgcgtccgccgcgcccggtgccagaaacgatgcccgtcgtctgcatc
ggcgcctcgaccggcggcaccgaagccctgcgggacgttctcacggcactgcccgcctcc
gcgccgccgatcgtgatcgtccagcacatgccgcgcggcttcacggccgccttcgcgcgc
cggctcgactcgctctgcgccatcgaggtactggaggcggaggatgagatgcaggtcatg
cccggccgcgccatcatcgcgcagggcgaccgccacctgctgcttcggcgccgcaatcag
ggctaccgcgtgtcggtgctggatggcgcctacgtctgccgccaccgaccctctgtcgat
gtgctcttccgctcggcggcgcaggaagcgggcgggaacgcgctcggtgtcatcatgacg
ggcatgggtgacgacggagcgcgctgcatggccgagatgcgtgcggccggcgcggaaacc
attgcccagaacgaagaaagctgcgtcgtctacggaatgccgcgcgaggcggtggcccat
ggcggggtcgggaaggtagagcctctggacaggctcgcggcccggatcatggaattcggc
cggcgccacacggaaaggaccgtccgatga

DBGET integrated database retrieval system