KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1595Help
Entry
RSP_1595          CDS       T00284                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rsp00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:189713..191020
Genome map
AA seq 435 aa AA seqDB search
MDARSINAKLRRGEVPSAAELGWFAEGLASGHVTDAQAGAFAMAVCLQGLGEEGRVALTR
AMRDSGRVLAWDLPGPVLDKHSTGGIGDCTSLLLAPALAACGAYVPMISGRGLGHTGGTL
DKLEAIPGFRVALGEERLRAQIEDVRCAIVAADEGMAPADRRLYLIRDVTGTVESIDLIT
ASILSKKLAAGLEGLVLDVKVGSGAFMKSMDEAEALARALVGTAQGAGCMTSALITDMSQ
PLATAAGNALEVIEVMETLTGTSINAALWDVTVALGGEALALGGLAADAEDGAHRIEQAL
ESGHAAEFFARMVAAQGGPVDFVERWPDRLPSAPVMREVPSLRTGFVLRIDTAALGQAVV
HLGGGRLRETDRVNPSVGLADIAGIGEEVSEDLPLAMIHAATEADADAAVAAIQAAYVIS
DQEPAEPPLIHARIA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcgcgatcgatcaacgcaaagctgcgccggggcgaagtgccctcggccgctgaa
ctgggctggttcgcggaaggtctggcctcggggcatgtcaccgatgcgcaggccggcgcc
ttcgccatggcggtctgcctgcagggtctgggcgaggaggggcgtgtggccctgacgcgc
gccatgcgcgactccggccgggtgctcgcctgggacctgccggggccggtgctcgacaaa
cattcgacgggcggcatcggagactgcacctcgctgctcctcgcgccggctctggctgcc
tgcggggcctatgtgccgatgatctcgggtcggggcctcggccatacggggggcacgctc
gacaagctggaagcgatccccggcttccgcgtggccctgggcgaagagcggttgcgcgcg
cagatcgaggatgtccgctgcgccatcgtcgccgccgacgagggcatggcgcccgcggac
cggcggctctacctcatccgcgacgtgaccggcacggtcgaatcgatcgacctcatcacc
gcgtcgatcctgtcgaagaagctggcggccgggctcgaggggctggtgctcgatgtgaaa
gtgggttcgggcgccttcatgaagtcgatggacgaggccgaggcgctggcgcgtgcgctg
gtgggcacggcgcagggggcgggctgcatgacatcggccctcatcaccgacatgagccag
ccgctcgcgaccgcggccggcaatgcgctcgaggtgatcgaggtgatggagacgctgacc
ggcacctcgatcaatgccgcgctctgggacgtgacggtggcgctcggcggcgaggccctg
gcgctgggcggccttgccgccgacgccgaggacggggcgcaccggatcgagcaggcgctg
gagagcgggcatgcggccgaattcttcgcccgcatggtggcggcgcagggcggcccggtc
gatttcgtcgagcgctggcccgaccggctgccctcggcccccgtgatgcgcgaggtgccg
agcctgcgcacgggcttcgtgctgcgcatcgacacggcggcgctcggtcaggcggtggtg
catctgggtggcgggcggctgcgcgagaccgaccgggtgaatccctcggtgggtctggcc
gatatcgccgggatcggcgaggaagtgtccgaggatctgccgctcgccatgatccatgcc
gcgaccgaggccgatgccgatgctgcggtggccgcgattcaggcggcctatgtgatctcg
gatcaggaaccggccgagccgccgctcatccatgcgaggatcgcctga

DBGET integrated database retrieval system