KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1668Help
Entry
RSP_1668          CDS       T00284                                 

Gene name
FolK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSP_1668 (FolK)
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RSP_1668 (FolK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:259550..260086
Genome map
AA seq 178 aa AA seqDB search
MPSAGRFPEGNVSEAISAVASAFQAPFRVSRLFKTPFFPAGAAPDFVNAAMALHLTDDVD
PRKILARLHEIEADFGRSRSHRWADRTLDLDLIALDDSVWPDADTQERWRHLPPEEQARR
TPDGLILPHPRLQDRAFVLVPLADVAPDWRHPLLGLTVREMLAALPEAERAAAVPLEA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccatctgcgggaaggttcccggagggcaacgtttccgaggcgatttctgcggttgcg
agcgcatttcaagccccatttcgggtgagcaggctgttcaaaacgcccttttttcccgcg
ggcgcagcccctgattttgtcaatgcggccatggctctgcaccttacggatgatgtcgat
ccccgcaagatcctcgcacggctgcacgagatcgaggcggattttggccgatcccggtcg
cacagatgggccgaccggacgctcgacctcgatctcatcgccctggatgattcggtctgg
cccgacgccgacacccaggagcggtggaggcaccttcctcccgaggagcaggcccgccgc
acgccggacgggctcatattgccgcacccccgacttcaggaccgggccttcgtgctcgtc
ccgctggccgacgtggcgcccgactggcgccatccgctgcttggcctgacggtgagagag
atgctcgcggcgctgcccgaggcggagcgggccgctgccgtgccgctcgaggcttga

DBGET integrated database retrieval system