KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1824Help
Entry
RSP_1824          CDS       T00284                                 

Gene name
adh
Definition
Zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RSP_1824 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_1824 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    RSP_1824 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSP_1824 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSP_1824 (adh)
   00626 Naphthalene degradation
    RSP_1824 (adh)
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSP_1824 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:415374..416498
Genome map
AA seq 374 aa AA seqDB search
MKITAAVLERDGIAGNYAEERPLAIRELDLAEPGPGEVLIRVAAAGICHSDLSVINGTRR
RPLPMVLGHEASGHVEALGEGVEDLEHGDHVVCIFAPGCGRCTPCAEGRPALCEKAARHH
AVGELMTGHRRLSLGGRSVHHHLGISGFATHAVVARPSLVRVPREVPPHVSALFSCAMLT
GAGAVFNTAQIRPGSKVAVVGLGGVGLSAILGAAAAGAAEIVAIDPFPAKMEAARAMGAT
LSVPADGDTVAAVRDLTAGGVDYAFELAGSVRALETAFAVTRRGGMTVTAGLPHPDDRMS
LEALKLVAEERTLKGSYIGSCVPQRDLPRMLALHRRGLLPVEKMLTHRLKLDEINLAMDR
LAKGSAIRQVVDLG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacggcggcggtgctcgaacgcgacgggatcgcggggaattatgccgaggag
cggccgctcgcgatccgcgagctcgatctcgcggagccggggccgggcgaggtcctgatc
cgggtggccgccgcgggcatctgccattccgacctgtcggtcatcaacggcacgcggcgg
cggccgctgccgatggtgctcggccacgaggcctcgggccatgtcgaggctctgggcgag
ggggtcgaggatctcgagcacggcgaccatgtcgtctgcatcttcgcacccggctgcggc
cgctgcacgccctgcgccgaggggcggcctgcgctctgcgagaaggcggcgcgccatcat
gcggtgggcgaactgatgaccgggcaccggcggctgtcgctcggcgggcggtccgtgcac
catcacctcggcatctcgggcttcgccacccatgccgtggtggcgcggccgtcgctggtc
cgcgtcccgcgcgaggtcccgccccatgtctcggcgcttttctcctgcgccatgctgacg
ggggcgggggccgtcttcaacacggcgcagatccggcccggctcgaaggtcgccgtggtg
gggctgggcggcgtcggcctgtccgccatcctcggcgcggcggcggccggagcggccgag
atcgtggcgatcgacccgtttcccgccaagatggaggccgcgcgcgccatgggcgcgacg
ctctcggtgcccgcggacggagatacggtggcggcggtgcgcgacctgacggcgggcggc
gtcgattacgccttcgagctggcgggctcggtccgggcgctcgaaaccgccttcgccgtc
acccgccgcggcggcatgacggtgaccgcgggcctgccccacccggacgaccggatgtcg
ctcgaggcactgaagctcgtggccgaggagcgcaccctgaagggcagttacatcgggtcc
tgcgtgccccagcgcgacctgccgcggatgctggcgctgcaccgccgcggcctgctgccg
gtcgagaagatgctgacccaccggctgaagctcgacgagatcaacctcgcgatggaccgg
ctggccaagggcagcgcgatccggcaggtggtggacctcggctga

DBGET integrated database retrieval system