KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1831Help
Entry
RSP_1831          CDS       T00284                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSP_1831 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSP_1831 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RSP_1831 (thrC)
Enzymes [BR:rsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RSP_1831 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:422504..423889
Genome map
AA seq 461 aa AA seqDB search
MQYISTRGTAPVLGFGEAMLTGLARDGGLYVPESVPALSESEIAALAGLSYEEVAFRIMR
PFVGETFGDDEFRGLIAAAYEGFGHAARAPLVQLGPNHFLLELFHGPTLAFKDFAMQLIG
QLFQAALAKNGQRITIVGATSGDTGSAAIEAFRGLSNVDVFILFPHGRVSEVQRRQMTTP
SEPNVHALAVDGDFDDCQARLKDMFNDFAFRDAVGLAGVNSINWARVLAQVVYYFTSAVA
LGAPHREVSFTVPTGNFGDIFAGYIARRMGLPIARLVVATNQNDILHRALSTGAYETEGV
TPSISPSMDIQVSSNFERALFDAYGRDGAAVAALMAELKEGGFRISENALGTLRATFASG
RASEEETLATIRATHAATGELLCPHSAVGVKVAEEALGPEPMITLATAHPAKFPDAVEAA
TGLRPPLPARMADLFDRPERVTRVPNDLSALETLIRERTGR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatatctcgactcgcggcacggctccggttctcggcttcggcgaggccatgctg
acgggccttgcccgggacggcggtctctatgtgcccgagtcggtgcccgccctgtcggag
tccgagatcgcggcgctggcgggcctgtcctacgaggaggtggccttccgcatcatgcgg
cccttcgtgggagagaccttcggcgacgacgagttccgcggcctgatcgccgccgcctac
gagggcttcggccatgccgcccgcgcgccgctggtgcaactcggcccgaaccacttcctg
ctcgagctgttccacgggcccacgctcgccttcaaggacttcgccatgcagctgatcggc
cagctgttccaggcggcgctggcgaagaacgggcaacggatcaccatcgtcggcgccacc
tcgggcgacaccggctcggccgcgatcgaggccttccgcggcctctcgaacgtcgatgtc
tttatcctcttcccgcacggccgcgtgtccgaggtgcagcgacgccagatgacgacgccg
tccgagccgaacgttcacgccctcgcggtggacggcgacttcgacgattgccaggcccgg
ctgaaggacatgttcaacgacttcgccttccgcgatgcggtggggctggctggcgtcaat
tcgatcaactgggcgcgggtgctggcgcaggtcgtctattacttcacctcggccgtggcg
ctcggcgcgccgcaccgcgaggtgagcttcacggtgcccaccggcaatttcggcgacatc
ttcgcgggctacatcgcgcggcgcatggggctgcccatcgcccgcctcgtggtggccacc
aaccagaacgacatcctgcaccgtgcgctctcgacgggcgcctacgagaccgagggcgtc
acgccgtcgatcagcccctcgatggacatccaggtctcctcgaacttcgagcgggccttg
ttcgatgcctatggccgcgacggggcggcggtggcagccctcatggccgagctgaaggag
ggcggcttccgcatctccgaaaatgcgctggggacgctgcgcgcgaccttcgcctcgggc
cgcgcctccgaggaagagacgctggccacgatccgcgccacccatgcggcgacgggcgag
cttctctgcccccattcggccgtgggcgtgaaggtggccgaggaggcgctcggccccgag
ccgatgatcacgctcgccaccgcccatccggccaagttccccgatgcggtcgaggcggcc
actggcctgcgcccgccgctgcctgcccgcatggccgatctcttcgaccgacccgagcgg
gtgacgcgcgttcccaacgacctgtccgccctcgaaaccctcatccgcgaaaggaccggg
cgttga

DBGET integrated database retrieval system