KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1831Help
Entry
RSP_1831          CDS       T00284                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSP_1831 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSP_1831 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RSP_1831 (thrC)
Enzymes [BR:rsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RSP_1831 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:422504..423889
Genome map
AA seq 461 aa AA seqDB search
MQYISTRGTAPVLGFGEAMLTGLARDGGLYVPESVPALSESEIAALAGLSYEEVAFRIMR
PFVGETFGDDEFRGLIAAAYEGFGHAARAPLVQLGPNHFLLELFHGPTLAFKDFAMQLIG
QLFQAALAKNGQRITIVGATSGDTGSAAIEAFRGLSNVDVFILFPHGRVSEVQRRQMTTP
SEPNVHALAVDGDFDDCQARLKDMFNDFAFRDAVGLAGVNSINWARVLAQVVYYFTSAVA
LGAPHREVSFTVPTGNFGDIFAGYIARRMGLPIARLVVATNQNDILHRALSTGAYETEGV
TPSISPSMDIQVSSNFERALFDAYGRDGAAVAALMAELKEGGFRISENALGTLRATFASG
RASEEETLATIRATHAATGELLCPHSAVGVKVAEEALGPEPMITLATAHPAKFPDAVEAA
TGLRPPLPARMADLFDRPERVTRVPNDLSALETLIRERTGR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatatctcgactcgcggcacggctccggttctcggcttcggcgaggccatgctg
acgggccttgcccgggacggcggtctctatgtgcccgagtcggtgcccgccctgtcggag
tccgagatcgcggcgctggcgggcctgtcctacgaggaggtggccttccgcatcatgcgg
cccttcgtgggagagaccttcggcgacgacgagttccgcggcctgatcgccgccgcctac
gagggcttcggccatgccgcccgcgcgccgctggtgcaactcggcccgaaccacttcctg
ctcgagctgttccacgggcccacgctcgccttcaaggacttcgccatgcagctgatcggc
cagctgttccaggcggcgctggcgaagaacgggcaacggatcaccatcgtcggcgccacc
tcgggcgacaccggctcggccgcgatcgaggccttccgcggcctctcgaacgtcgatgtc
tttatcctcttcccgcacggccgcgtgtccgaggtgcagcgacgccagatgacgacgccg
tccgagccgaacgttcacgccctcgcggtggacggcgacttcgacgattgccaggcccgg
ctgaaggacatgttcaacgacttcgccttccgcgatgcggtggggctggctggcgtcaat
tcgatcaactgggcgcgggtgctggcgcaggtcgtctattacttcacctcggccgtggcg
ctcggcgcgccgcaccgcgaggtgagcttcacggtgcccaccggcaatttcggcgacatc
ttcgcgggctacatcgcgcggcgcatggggctgcccatcgcccgcctcgtggtggccacc
aaccagaacgacatcctgcaccgtgcgctctcgacgggcgcctacgagaccgagggcgtc
acgccgtcgatcagcccctcgatggacatccaggtctcctcgaacttcgagcgggccttg
ttcgatgcctatggccgcgacggggcggcggtggcagccctcatggccgagctgaaggag
ggcggcttccgcatctccgaaaatgcgctggggacgctgcgcgcgaccttcgcctcgggc
cgcgcctccgaggaagagacgctggccacgatccgcgccacccatgcggcgacgggcgag
cttctctgcccccattcggccgtgggcgtgaaggtggccgaggaggcgctcggccccgag
ccgatgatcacgctcgccaccgcccatccggccaagttccccgatgcggtcgaggcggcc
actggcctgcgcccgccgctgcctgcccgcatggccgatctcttcgaccgacccgagcgg
gtgacgcgcgttcccaacgacctgtccgccctcgaaaccctcatccgcgaaaggaccggg
cgttga

DBGET integrated database retrieval system