KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1862Help
Entry
RSP_1862          CDS       T00284                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSP_1862
Enzymes [BR:rsp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RSP_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:460532..461569
Genome map
AA seq 345 aa AA seqDB search
MTYVRPIPLADAARPEGALPLAGGPLFFDLVEILERGRAPVVLPAAELDPATLAPLTAPR
PPVAGLAMGRPQIMGILNVTPDSFSDGGRFAALPEALAQAEALVAAGADILDIGGESTRP
GAAEVEPAEEIRRTAPVIERLRGQGIAVPVSIDTRKAPVAEAALIAGADLVNDVAALTWD
AGLAAVAARREAPVCLMHAQGTPQTMQADPRYDDVLLDVYDWLAERIRAAEAAGIPRARI
VTDPGIGFGKTLEHNLALLRRLSLFHGLGCPILLGASRKRFIGTLADEPSAERRMAGSVA
VALAGAAQGAQILRVHDVRETRQALILWQAVTREAAETAAERRQA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacctatgtccgtccgatcccgctcgccgatgcggcccgccccgagggcgcgctgccg
ctcgccggcggtccgctgttcttcgacctcgtcgagatcctcgaacgcggacgcgcacct
gtcgtgctgcccgcagccgagctcgatccggccacgctcgcccccctgacggcgccgcgg
cccccggtggcggggctcgccatgggccggccgcagatcatgggcatcctcaacgtgacg
cccgacagtttttcggacggcggccggttcgcggcgctgcccgaggcgctggcacaggcc
gaggcgctggtggcggcgggggcggacatcctcgacatcggcggcgagagcacgcggccc
ggtgctgcggaggtggagccggccgaggagatccgccgcaccgcgccggtgatcgagagg
ctgcgggggcaggggatcgccgtgccggtctcgatcgacacccgcaaggccccggtggcc
gaggccgcgctgatcgcgggggccgatctcgtgaacgatgtggcggccctgacctgggac
gcagggctggccgccgtggcggcgcggcgggaggcgccggtctgcctcatgcatgcgcag
ggtacgccgcagaccatgcaggccgatccgcgctacgacgacgtgctgctcgatgtctac
gactggctggccgagcgcatccgggcggccgaggcggcgggcatcccgcgcgcccggatc
gtgaccgacccgggcatcggcttcggcaagacgctcgagcacaatctggcgctgctgcgc
cggctgtcgctctttcacgggctgggctgtccgatcctgctcggcgcctcgcgcaagcgt
ttcatcggcacgctcgcggacgagccttcggccgaacggcgcatggcgggctcggtcgcc
gtcgcgcttgcgggcgcggcgcaaggagcgcagattctcagagtgcacgacgtgcgcgag
acacgtcaggcgctgatcctgtggcaggcagtcacacgcgaggcggcagagaccgcggca
gaacggaggcaggcatga

DBGET integrated database retrieval system