KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1862Help
Entry
RSP_1862          CDS       T00284                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rsp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:460532..461569
Genome map
AA seq 345 aa AA seqDB search
MTYVRPIPLADAARPEGALPLAGGPLFFDLVEILERGRAPVVLPAAELDPATLAPLTAPR
PPVAGLAMGRPQIMGILNVTPDSFSDGGRFAALPEALAQAEALVAAGADILDIGGESTRP
GAAEVEPAEEIRRTAPVIERLRGQGIAVPVSIDTRKAPVAEAALIAGADLVNDVAALTWD
AGLAAVAARREAPVCLMHAQGTPQTMQADPRYDDVLLDVYDWLAERIRAAEAAGIPRARI
VTDPGIGFGKTLEHNLALLRRLSLFHGLGCPILLGASRKRFIGTLADEPSAERRMAGSVA
VALAGAAQGAQILRVHDVRETRQALILWQAVTREAAETAAERRQA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacctatgtccgtccgatcccgctcgccgatgcggcccgccccgagggcgcgctgccg
ctcgccggcggtccgctgttcttcgacctcgtcgagatcctcgaacgcggacgcgcacct
gtcgtgctgcccgcagccgagctcgatccggccacgctcgcccccctgacggcgccgcgg
cccccggtggcggggctcgccatgggccggccgcagatcatgggcatcctcaacgtgacg
cccgacagtttttcggacggcggccggttcgcggcgctgcccgaggcgctggcacaggcc
gaggcgctggtggcggcgggggcggacatcctcgacatcggcggcgagagcacgcggccc
ggtgctgcggaggtggagccggccgaggagatccgccgcaccgcgccggtgatcgagagg
ctgcgggggcaggggatcgccgtgccggtctcgatcgacacccgcaaggccccggtggcc
gaggccgcgctgatcgcgggggccgatctcgtgaacgatgtggcggccctgacctgggac
gcagggctggccgccgtggcggcgcggcgggaggcgccggtctgcctcatgcatgcgcag
ggtacgccgcagaccatgcaggccgatccgcgctacgacgacgtgctgctcgatgtctac
gactggctggccgagcgcatccgggcggccgaggcggcgggcatcccgcgcgcccggatc
gtgaccgacccgggcatcggcttcggcaagacgctcgagcacaatctggcgctgctgcgc
cggctgtcgctctttcacgggctgggctgtccgatcctgctcggcgcctcgcgcaagcgt
ttcatcggcacgctcgcggacgagccttcggccgaacggcgcatggcgggctcggtcgcc
gtcgcgcttgcgggcgcggcgcaaggagcgcagattctcagagtgcacgacgtgcgcgag
acacgtcaggcgctgatcctgtggcaggcagtcacacgcgaggcggcagagaccgcggca
gaacggaggcaggcatga

DBGET integrated database retrieval system