KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1947Help
Entry
RSP_1947          CDS       T00284                                 

Gene name
cbbJ
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSP_1947 (cbbJ)
   01230 Biosynthesis of amino acids
    RSP_1947 (cbbJ)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_1947 (cbbJ)
   00051 Fructose and mannose metabolism
    RSP_1947 (cbbJ)
   00562 Inositol phosphate metabolism
    RSP_1947 (cbbJ)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RSP_1947 (cbbJ)
Enzymes [BR:rsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RSP_1947 (cbbJ)
Exosome [BR:rsp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RSP_1947 (cbbJ)
  Exosomal proteins of bladder cancer cells
   RSP_1947 (cbbJ)
  Exosomal proteins of melanoma cells
   RSP_1947 (cbbJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(545185..545922)
Genome map
AA seq 245 aa AA seqDB search
MRKLAAGNWKMNGTEADLGEIDALLAAHPSPRCEMLICPPATLVARMAGRAAQGLMVGGQ
DCHPKTSGAHTGDVSAAMLADAGASHVILGHSERRADHGETDSLVRLKAEAAWGAGLVAI
VCVGETEAQRDAGQTLDVIGAQLAGSVPEAATAANTVIAYEPVWAIGTGRTPTTAEIAEV
HAFLRARLAERFSDAEGFRLLYGGSVKPSNAAEIFAVPNVDGALVGGASLKAADFGGIVA
ALSAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaacttgcggccggaaactggaagatgaacggaaccgaggcggatctgggcgag
atcgacgccctgctcgccgcgcatccgtcgccccgctgcgagatgctgatctgtccgccc
gcaacgcttgttgcgcgcatggcgggacgcgcggcgcagggcctgatggtcggcgggcag
gactgccaccccaagacctccggcgcccataccggcgacgtctcggccgccatgctcgcc
gatgccggggcgagccacgtcattctcggccattccgaacgccgcgccgatcatggcgag
acggactcgctcgtgcggctgaaggccgaagcggcctggggcgcgggccttgtcgccatc
gtctgcgtgggcgaaaccgaggcccagcgcgacgcgggccagacgctcgacgtgatcggg
gcacagcttgcgggctcggtgccggaagccgccaccgcggccaacaccgtgatcgcctac
gagccggtctgggccatcggcaccggccgcacgcccacgaccgccgagatcgccgaggtt
cacgccttcctccgcgcgcggctcgccgagcggttttcggatgcggagggcttccggctg
ctctacggcggctcggtgaagccgtcgaatgcggccgagatcttcgccgtgccgaatgtc
gatggcgcgctggtcggcggcgcgagcctcaaggccgcggatttcggcgggatcgtggcg
gccctttcggccgcctga

DBGET integrated database retrieval system