KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1980Help
Entry
RSP_1980          CDS       T00284                                 

Gene name
glcB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSP_1980 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSP_1980 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RSP_1980 (glcB)
Enzymes [BR:rsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RSP_1980 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(571674..573833)
Genome map
AA seq 719 aa AA seqDB search
MTDRIEKQGLQVDVRLAEFVAREALPGTGVSEETFWGGLADTVRTLGPRNRALLDRRAEL
QAAIDDWHRTHRGERPSLREYTAFLREIGYLLPEGPDFTIETAHVDPEIAEVAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDALGDLPEGAEFDPARGARVIAWGRRFLDETAPLA
QGSHADVEGYRVEGGALVPALADPAQFAGHAGPAEAPTAILLKNNGLHLILDIDRKHRIG
AADRAGVADIRMEAALSAIMDCEDSVAAVDGEDKALAYANWLGLMRGDLREAISKGGRMF
VRELAPDLAFTAPDGGTVTLKGRALMLVRNVGHLMTTPAVLDETGAEIFEGMLDAFATTL
CALHDLAKADGIRNSVAGSVYVVKPKMHGPDEVAFADELFTRVEEVLGLPHYTVKLGIMD
EERRTSVNLKECIRAAKHRVAFINTGFLDRTGDEIFTGMEAGPMVKKGDMKASRWIASYE
DRNVDIGLACGLRGRAQIGKGMWAMPDRMAEMLAAKIGHPKAGASCAWVPSPTAATLHAT
HYHRVDVTARQKEIAAGGPRGSLEDLLTLPVAEGVNWSEAELRQEIENNAQGILGYVVRW
VDQGVGCSKVPDINDVGLMEDRATCRISSQALVNWLHHGVVSEDQVMAALKKMAAVVDAQ
NAGDPAYRPMAPGFDGAAFQAACDLVFKGREQPSGYTEPVLHARRLQVKAERTPQVSRA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgatcggatcgagaagcaggggttgcaggtggatgtgcgtctggccgagttcgtg
gcccgcgaggcgctgcccggcaccggtgtcagcgaggaaaccttctggggaggcctcgcc
gacacggtgcgcactctcgggccgcggaaccgcgccctcctcgaccgccgcgccgagctt
caggctgccatcgacgactggcaccgcactcaccgcggcgagcggccgagccttagagag
tacaccgccttccttcgcgagatcggctacctgctgccggaggggcccgacttcaccatc
gagaccgcgcatgtcgatccagagatcgccgaggtggcggggccgcaactcgtggtgccg
gtgatgaatgcgcgctatgcgctgaacgcggccaacgcgcgctggggctcgctctatgac
gcgctctacggcaccgatgctctgggcgatctgccggagggtgcggagttcgaccctgcg
cggggcgcgcgggtcatcgcctgggggcgccggttcctcgatgagaccgcgccgctggcc
caaggcagccatgccgatgtcgagggctaccgggtcgagggcggcgcgctggtgcccgca
ctggcggatcccgcgcaatttgcgggccacgcggggcctgccgaggctccgacggccatc
cttctgaagaacaacgggctgcatctcatcctcgacattgatcgcaagcaccggatcggc
gccgccgaccgcgcgggcgtcgccgacatccgcatggaggccgcgctgtcggccatcatg
gattgcgaggattccgtcgccgcggtggatggcgaggacaaggcgctcgcctacgccaac
tggctgggcctgatgcgcggcgacctgcgcgaggcgatctcgaagggcgggcggatgttc
gtgcgcgagctcgcgcccgacctcgccttcaccgcgccggacggcgggaccgtcaccctc
aagggccgggcgctgatgctcgtgcgcaacgtgggccatctgatgaccacgcctgccgtg
ctcgacgagactggcgccgagatcttcgaggggatgctcgatgccttcgccaccaccctc
tgcgccctgcacgatctggccaaggccgacggcatccggaactcggtcgcaggctcggtc
tatgtggtgaagcccaagatgcacgggcccgacgaggtggccttcgccgacgagctcttc
acccgcgtggaggaggtgctgggcctgccgcactacacggtgaagctcggcatcatggac
gaggagcggcgcacctcggtcaatctgaaggagtgcatccgggccgcgaagcatcgggtg
gccttcatcaacacgggcttcctcgaccggacgggcgacgagatcttcaccggcatggag
gcgggcccgatggtgaagaagggggacatgaaggcctcgcgctggatcgcctcctacgag
gatcgcaacgtggacatcggtctggcctgcggcctgcgcgggcgcgcgcagatcggcaag
ggcatgtgggccatgcccgaccggatggccgagatgctggccgccaagatcggccacccg
aaggccggagcgagctgcgcctgggtgccctcgcccacggccgcaaccctgcatgccacc
cattatcaccgggtggacgtgaccgcgcgccagaaggagatcgcggcgggcggaccgcgc
ggcagcctcgaggacctgctgacgctgccggtggccgagggagtgaactggtccgaggcc
gagctgcgccaggagatcgagaacaatgcccagggcatcctcggctatgtggtgcgctgg
gtggatcagggcgtcggctgttcgaaggtgcccgacatcaacgacgtgggcctgatggaa
gaccgcgccacctgccggatctccagccaggcgctggtgaactggctgcaccacggtgtc
gtgtcggaagatcaggtgatggcggcgctgaagaagatggccgccgtggtggatgcgcag
aatgccggcgatccggcctaccggcccatggcgcccggcttcgacggcgcggccttccag
gcggcctgcgacctcgtcttcaagggccgcgagcagccctcgggctataccgagccggtg
ctccatgcccggcgcctgcaggtgaaggccgagcgcacgccgcaggtcagccgcgcctga

DBGET integrated database retrieval system