KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1980Help
Entry
RSP_1980          CDS       T00284                                 

Gene name
glcB
Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00620  Pyruvate metabolism
rsp00630  Glyoxylate and dicarboxylate metabolism
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01120  Microbial metabolism in diverse environments
rsp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSP_1980 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RSP_1980 (glcB)
Enzymes [BR:rsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RSP_1980 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 3719313
NCBI-ProteinID: YP_352031
UniProt: Q3J504
Position
1:complement(571674..573833)
Genome map
AA seq 719 aa AA seqDB search
MTDRIEKQGLQVDVRLAEFVAREALPGTGVSEETFWGGLADTVRTLGPRNRALLDRRAEL
QAAIDDWHRTHRGERPSLREYTAFLREIGYLLPEGPDFTIETAHVDPEIAEVAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDALGDLPEGAEFDPARGARVIAWGRRFLDETAPLA
QGSHADVEGYRVEGGALVPALADPAQFAGHAGPAEAPTAILLKNNGLHLILDIDRKHRIG
AADRAGVADIRMEAALSAIMDCEDSVAAVDGEDKALAYANWLGLMRGDLREAISKGGRMF
VRELAPDLAFTAPDGGTVTLKGRALMLVRNVGHLMTTPAVLDETGAEIFEGMLDAFATTL
CALHDLAKADGIRNSVAGSVYVVKPKMHGPDEVAFADELFTRVEEVLGLPHYTVKLGIMD
EERRTSVNLKECIRAAKHRVAFINTGFLDRTGDEIFTGMEAGPMVKKGDMKASRWIASYE
DRNVDIGLACGLRGRAQIGKGMWAMPDRMAEMLAAKIGHPKAGASCAWVPSPTAATLHAT
HYHRVDVTARQKEIAAGGPRGSLEDLLTLPVAEGVNWSEAELRQEIENNAQGILGYVVRW
VDQGVGCSKVPDINDVGLMEDRATCRISSQALVNWLHHGVVSEDQVMAALKKMAAVVDAQ
NAGDPAYRPMAPGFDGAAFQAACDLVFKGREQPSGYTEPVLHARRLQVKAERTPQVSRA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgatcggatcgagaagcaggggttgcaggtggatgtgcgtctggccgagttcgtg
gcccgcgaggcgctgcccggcaccggtgtcagcgaggaaaccttctggggaggcctcgcc
gacacggtgcgcactctcgggccgcggaaccgcgccctcctcgaccgccgcgccgagctt
caggctgccatcgacgactggcaccgcactcaccgcggcgagcggccgagccttagagag
tacaccgccttccttcgcgagatcggctacctgctgccggaggggcccgacttcaccatc
gagaccgcgcatgtcgatccagagatcgccgaggtggcggggccgcaactcgtggtgccg
gtgatgaatgcgcgctatgcgctgaacgcggccaacgcgcgctggggctcgctctatgac
gcgctctacggcaccgatgctctgggcgatctgccggagggtgcggagttcgaccctgcg
cggggcgcgcgggtcatcgcctgggggcgccggttcctcgatgagaccgcgccgctggcc
caaggcagccatgccgatgtcgagggctaccgggtcgagggcggcgcgctggtgcccgca
ctggcggatcccgcgcaatttgcgggccacgcggggcctgccgaggctccgacggccatc
cttctgaagaacaacgggctgcatctcatcctcgacattgatcgcaagcaccggatcggc
gccgccgaccgcgcgggcgtcgccgacatccgcatggaggccgcgctgtcggccatcatg
gattgcgaggattccgtcgccgcggtggatggcgaggacaaggcgctcgcctacgccaac
tggctgggcctgatgcgcggcgacctgcgcgaggcgatctcgaagggcgggcggatgttc
gtgcgcgagctcgcgcccgacctcgccttcaccgcgccggacggcgggaccgtcaccctc
aagggccgggcgctgatgctcgtgcgcaacgtgggccatctgatgaccacgcctgccgtg
ctcgacgagactggcgccgagatcttcgaggggatgctcgatgccttcgccaccaccctc
tgcgccctgcacgatctggccaaggccgacggcatccggaactcggtcgcaggctcggtc
tatgtggtgaagcccaagatgcacgggcccgacgaggtggccttcgccgacgagctcttc
acccgcgtggaggaggtgctgggcctgccgcactacacggtgaagctcggcatcatggac
gaggagcggcgcacctcggtcaatctgaaggagtgcatccgggccgcgaagcatcgggtg
gccttcatcaacacgggcttcctcgaccggacgggcgacgagatcttcaccggcatggag
gcgggcccgatggtgaagaagggggacatgaaggcctcgcgctggatcgcctcctacgag
gatcgcaacgtggacatcggtctggcctgcggcctgcgcgggcgcgcgcagatcggcaag
ggcatgtgggccatgcccgaccggatggccgagatgctggccgccaagatcggccacccg
aaggccggagcgagctgcgcctgggtgccctcgcccacggccgcaaccctgcatgccacc
cattatcaccgggtggacgtgaccgcgcgccagaaggagatcgcggcgggcggaccgcgc
ggcagcctcgaggacctgctgacgctgccggtggccgagggagtgaactggtccgaggcc
gagctgcgccaggagatcgagaacaatgcccagggcatcctcggctatgtggtgcgctgg
gtggatcagggcgtcggctgttcgaaggtgcccgacatcaacgacgtgggcctgatggaa
gaccgcgccacctgccggatctccagccaggcgctggtgaactggctgcaccacggtgtc
gtgtcggaagatcaggtgatggcggcgctgaagaagatggccgccgtggtggatgcgcag
aatgccggcgatccggcctaccggcccatggcgcccggcttcgacggcgcggccttccag
gcggcctgcgacctcgtcttcaagggccgcgagcagccctcgggctataccgagccggtg
ctccatgcccggcgcctgcaggtgaaggccgagcgcacgccgcaggtcagccgcgcctga

DBGET integrated database retrieval system